Burkholderia mallei 2000031063: DM57_2552 Help Entry DM57_2552         CDS       T03522                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism bmai  Burkholderia mallei 2000031063 Pathway bmai00998   Biosynthesis of various antibiotics bmai01100   Metabolic pathways bmai01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:bmai00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     DM57_2552    00074 Mycolic acid biosynthesis     DM57_2552   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     DM57_2552 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 DUF7080 Ribosomal_L50 DUF1896 DUF1493 Motif Other DBs NCBI-ProteinID:  AIO79530 LinkDB All DBs Position 1:complement(702378..702617) Genome browser AA seq 79 aa AA seqDB search MDNIEQRVKKIVAEQLGVAEAEIKNEASFVNDLGADSLDTVELVMALEDEFGMEIPDEEA EKITTVQQAVDYARANVKA NT seq 240 nt NT seq  +upstreamnt  +downstreamnt atggacaacatcgaacaacgcgtgaagaagatcgtcgccgaacaactgggcgtcgccgaa gccgaaatcaagaacgaagcgtcgttcgtgaacgacctcggcgcggactcgctcgacacg gtcgagctggtgatggcgctcgaagacgagttcggcatggaaatcccggatgaagaggcc gagaagatcacgaccgttcagcaagcggtcgactacgctcgcgcgaacgtcaaggcgtaa

DBGET integrated database retrieval system