Burkholderia mallei 23344: DM55_1022 Help Entry DM55_1022         CDS       T03323                                  Name (GenBank) cyd operon protein YbgT   KO K00424   cytochrome bd-I ubiquinol oxidase subunit X [EC:7.1.1.7] Organism bmal  Burkholderia mallei 23344 Pathway bmal00190   Oxidative phosphorylation bmal01100   Metabolic pathways bmal02020   Two-component system Module bmal_M00153   Cytochrome bd ubiquinol oxidase Brite KEGG Orthology (KO) [BR:bmal00001]  09100 Metabolism   09102 Energy metabolism    00190 Oxidative phosphorylation     DM55_1022  09130 Environmental Information Processing   09132 Signal transduction    02020 Two-component system     DM55_1022 Enzymes [BR:bmal01000]  7. Translocases   7.1  Catalysing the translocation of protons    7.1.1  Linked to oxidoreductase reactions     7.1.1.7  quinol oxidase (electrogenic, proton-motive force generating)      DM55_1022 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  YbgT_YccB Motif Other DBs NCBI-ProteinID:  AIO51896 UniProt:  A0AAX1X7S8 LinkDB All DBs Position 1:1119502..1119600 Genome browser AA seq 32 aa AA seqDB search MWYFSWILGIGVALAFGIINAMWLEARQKRDA NT seq 99 nt NT seq  +upstreamnt  +downstreamnt atgtggtacttcagctggattctcggcatcggcgtcgcgctcgcgttcggcatcatcaat gcgatgtggctcgaagcgcggcaaaagcgcgacgcgtag

DBGET integrated database retrieval system