Burkholderia mallei 23344: DM55_1921 Help Entry DM55_1921         CDS       T03323                                  Symbol acpP Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism bmal  Burkholderia mallei 23344 Pathway bmal00998   Biosynthesis of various antibiotics bmal01100   Metabolic pathways bmal01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:bmal00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     DM55_1921 (acpP)    00074 Mycolic acid biosynthesis     DM55_1921 (acpP)   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     DM55_1921 (acpP) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 DUF7080 Ribosomal_L50 DUF1896 DUF1493 Motif Other DBs NCBI-ProteinID:  AIO51484 UniProt:  A0AAX1X652 LinkDB All DBs Position 1:2090511..2090750 Genome browser AA seq 79 aa AA seqDB search MDNIEQRVKKIVAEQLGVAEAEIKNEASFVNDLGADSLDTVELVMALEDEFGMEIPDEEA EKITTVQQAIDYARANVKA NT seq 240 nt NT seq  +upstreamnt  +downstreamnt atggacaacatcgaacaacgcgtgaagaagatcgtcgccgaacaactgggcgtcgccgaa gccgaaatcaagaacgaagcgtcgttcgtgaacgacctcggcgcggactcgctcgacacg gtcgagctggtgatggcgctcgaagacgagttcggcatggaaatcccggatgaagaggcc gagaagatcacgaccgttcagcaagcgatcgactacgctcgcgcgaacgtcaaggcgtaa

DBGET integrated database retrieval system