Burkholderia mallei 23344: DM55_4861 Help Entry DM55_4861         CDS       T03323                                  Name (GenBank) H-NS histone family protein   KO K03746   DNA-binding protein H-NS Organism bmal  Burkholderia mallei 23344 Brite KEGG Orthology (KO) [BR:bmal00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:bmal03036]     DM55_4861    03400 DNA repair and recombination proteins [BR:bmal03400]     DM55_4861 Chromosome and associated proteins [BR:bmal03036]  Prokaryotic type   Nucleoid associated proteins    HNS (histone-like nucleoid structuring protein)     DM55_4861 DNA repair and recombination proteins [BR:bmal03400]  Prokaryotic type   DSBR (double strand breaks repair)    NHEJ (non-homologous end-joining)     SHDIR (short-homology-dependent illegitimate recombination)      Supressor       DM55_4861 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Histone_HNS HalX Motif Other DBs NCBI-ProteinID:  AIO54799 UniProt:  A0AAX1XDX4 LinkDB All DBs Position 2:complement(1990918..1991208) Genome browser AA seq 96 aa AA seqDB search MATYKELKARAEALSAQAEAARQAELQAAIEDVRAKVREYGLTAYDVFGHRKKPGERHRG AVRPKYRDPATGATWTGRGIEPKWIRGRNRDEFLIE NT seq 291 nt NT seq  +upstreamnt  +downstreamnt atggcgacatacaaggaactgaaggctcgggccgaggcgctgagcgcgcaggccgaagcg gcgcggcaggctgaattgcaggccgcgatcgaagacgtgcgcgcgaaggtgcgcgagtac ggtctcacggcgtacgacgtgttcggacaccgaaagaagccgggcgagcgccatcgcggg gcggtcaggccgaagtaccgcgatccggcgacgggcgcgacctggaccggacgcggcatc gagccgaaatggatccggggccgtaatcgggacgaattcctgatcgaatga

DBGET integrated database retrieval system