Bombyx mandarina (wild silkworm): 114239436 Help Entry 114239436         CDS       T05882                                  Name (RefSeq) ras-related protein Rab-7a   KO K07897   Ras-related protein Rab-7A Organism bman  Bombyx mandarina (wild silkworm) Pathway bman04137   Mitophagy - animal bman04140   Autophagy - animal bman04144   Endocytosis bman04145   Phagosome bman04148   Efferocytosis Brite KEGG Orthology (KO) [BR:bman00001]  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     114239436    04145 Phagosome     114239436    04140 Autophagy - animal     114239436    04137 Mitophagy - animal     114239436    04148 Efferocytosis     114239436  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:bman04131]     114239436   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:bman04147]     114239436    04031 GTP-binding proteins [BR:bman04031]     114239436 Membrane trafficking [BR:bman04131]  Endosome - Lysosome transport   Rab GTPases and associated proteins    Rab GTPases     114239436 Exosome [BR:bman04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    114239436   Exosomal proteins of other body fluids (saliva and urine)    114239436   Exosomal proteins of colorectal cancer cells    114239436   Exosomal proteins of bladder cancer cells    114239436 GTP-binding proteins [BR:bman04031]  Small (monomeric) G-proteins   Rab Family    Rab7/9 [OT]     114239436 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Ras Roc Arf MMR_HSR1 GTP_EFTU Gtr1_RagA RsgA_GTPase ATP_bind_1 nSTAND3 cobW Septin AAA_16 AAA_24 PduV-EutP AAA_22 NACHT AAA_5 AAA_7 ATPase_2 NTPase_1 SRPRB G-alpha ABC_tran AAA_14 ATP-synt_ab NB-ARC TniB RNA_helicase PRK Motif Other DBs NCBI-GeneID:  114239436 NCBI-ProteinID:  XP_028025427 UniProt:  A0A6J2J8F7 LinkDB All DBs Position Unknown AA seq 208 aa AA seqDB search MSSRKKLLLKVIILGDSGVGKTSLMNQFVNKKFSNQYKATIGADFLTKEVIVDDRIVTMQ IWDTAGQERFQSLGVAFYRGADCCVLVFDVTAPNTFKSLESWRDEFLIQASPRDPDNFPF VILGNKVDLDNRAVSVKRGQQWCQSKNDIPYFETSAKEAVNVELAFQTIARNALAQETEA ELYNEFPDQIKLNANDNGRNRDGDNCAC NT seq 627 nt NT seq  +upstreamnt  +downstreamnt atgtcttcacggaaaaagctcctgctaaaggtaattatcctgggtgacagcggtgttgga aaaacatctctgatgaatcagtttgtcaacaaaaaattttccaaccagtacaaggcgaca ataggtgcagattttctcacaaaagaagtaatcgttgacgatagaatcgttacgatgcaa atatgggatactgctggccaagaacggttccaatcgcttggagtagctttctatcgtggg gcggattgctgcgtattagtttttgacgtaactgcccccaacacgtttaagtccttggag agttggagagacgaattcctgatacaggcatcacctcgtgaccctgataatttccccttc gtaatattgggaaacaaagtcgacttggataatcgtgccgtttctgtcaaacgtggtcaa caatggtgccagagcaagaacgacatcccgtattttgagacaagtgccaaagaagctgtc aatgtagagctagcttttcaaacaatagcacgcaacgcattggcacaggaaaccgaagct gaactctacaatgaattccccgaccaaatcaaactgaatgctaatgacaatggaagaaac agggacggtgacaactgtgcttgctag

DBGET integrated database retrieval system