Bombyx mandarina (wild silkworm): 114240008 Help Entry 114240008         CDS       T05882                                  Name (RefSeq) elongin-B isoform X1   KO K03873   elongin-B Organism bman  Bombyx mandarina (wild silkworm) Pathway bman04120   Ubiquitin mediated proteolysis Brite KEGG Orthology (KO) [BR:bman00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04120 Ubiquitin mediated proteolysis     114240008  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04121 Ubiquitin system [BR:bman04121]     114240008    03400 DNA repair and recombination proteins [BR:bman03400]     114240008 Ubiquitin system [BR:bman04121]  Ubiquitin ligases (E3)   Multi subunit type E3    Cul2 complex     Adoptor protein      114240008    Cul5 complex      114240008 DNA repair and recombination proteins [BR:bman03400]  Eukaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     Other NER factors      114240008 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  ubiquitin Rad60-SLD Motif Other DBs NCBI-GeneID:  114240008 NCBI-ProteinID:  XP_028026262 UniProt:  A0A6J2JAU7 LinkDB All DBs Position Unknown AA seq 119 aa AA seqDB search MDVFLMIRRKKLTVFTDAKETTTVLELKKMIEGILKVSPPSQMLFNKDSQLMEDEKTLAE FGLTSNTAKAHCPAPIGLALRKENGEFEALELTPYSSPPDLPDVMKSQETNGQEQMDQH NT seq 360 nt NT seq  +upstreamnt  +downstreamnt atggatgtctttttaatgataaggcgaaaaaagcttactgtcttcactgatgcgaaggaa accactacagtattagagttgaagaaaatgattgaaggtatcctaaaggtatctcctcca agtcaaatgctgttcaacaaggacagccagctcatggaagatgagaagaccttggctgaa tttggcctgacctctaacacagcaaaggctcactgtccagcaccaattggattagctttg aggaaggagaatggtgaatttgaggcactggaacttaccccgtattcttcaccccccgac ttgccagatgttatgaaatctcaagagaccaatggacaggaacagatggatcaacattaa

DBGET integrated database retrieval system