Bombyx mandarina (wild silkworm): 114240716 Help Entry 114240716         CDS       T05882                                  Name (RefSeq) ras-related protein Rac1   KO K04392   Ras-related C3 botulinum toxin substrate 1 Organism bman  Bombyx mandarina (wild silkworm) Pathway bman04013   MAPK signaling pathway - fly bman04145   Phagosome bman04148   Efferocytosis bman04310   Wnt signaling pathway bman04620   Toll-like receptor signaling pathway bman05100   Bacterial invasion of epithelial cells Brite KEGG Orthology (KO) [BR:bman00001]  09130 Environmental Information Processing   09132 Signal transduction    04013 MAPK signaling pathway - fly     114240716    04310 Wnt signaling pathway     114240716  09140 Cellular Processes   09141 Transport and catabolism    04145 Phagosome     114240716    04148 Efferocytosis     114240716  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     114240716  09160 Human Diseases   09171 Infectious disease: bacterial    05100 Bacterial invasion of epithelial cells     114240716  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:bman04131]     114240716   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:bman04147]     114240716    04031 GTP-binding proteins [BR:bman04031]     114240716 Membrane trafficking [BR:bman04131]  Exocytosis   Small GTPases and associated proteins    Rho GTPases     114240716  Endocytosis   Lipid raft mediated endocytosis    Arf6-dependent endocytosis     114240716   Macropinocytosis    Ras GTPases     114240716  Others   NADPH oxidases (Nox) and associated proteins    Nox associated proteins     114240716 Exosome [BR:bman04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    114240716   Exosomal proteins of other body fluids (saliva and urine)    114240716   Exosomal proteins of colorectal cancer cells    114240716   Exosomal proteins of bladder cancer cells    114240716 GTP-binding proteins [BR:bman04031]  Small (monomeric) G-proteins   Rho Family    Rac/Cdc42 [OT]     114240716 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU CagD Motif Other DBs NCBI-GeneID:  114240716 NCBI-ProteinID:  XP_028027171 UniProt:  A0A6J2JCK2 LinkDB All DBs Position Unknown AA seq 193 aa AA seqDB search MQAIKCVVVGDGAVGKTCLLISYTTNAFPGEYIPTVFDNYSANVMVDGKPINLGLWDTAG QEDYDRLRPLSYPQTDVFLICFSLVNPASFENVRAKWYPEVRHHCPSTPIILVGTKLDLR EDKDTIEKLKDKKLAPITYTQGLGMSKEINAVKYLECSALTQKGLKTVFDEAIRAVLCPV QPIKGRRRHCSLF NT seq 582 nt NT seq  +upstreamnt  +downstreamnt atgcaggcaatcaagtgtgttgttgttggagatggtgccgtcggtaaaacatgtctgctc atcagttacactacaaatgcttttcccggcgaatatatacctacagtattcgacaattac tcggcgaatgtcatggtagatggaaagccaatcaacttgggcctttgggatacagccgga caggaagactacgatcgactccgccccctctcctacccacaaacggacgtcttccttata tgtttttcgctcgtcaacccagcctcattcgaaaacgttcgggccaagtggtatccagaa gttcggcatcactgcccgtcgacgcccatcatcctggtcgggaccaagctcgacttacgc gaagacaaggacaccattgagaagctcaaggacaagaaactagccccgatcacctacacg cagggtttgggcatgtccaaggagataaacgctgtcaagtatttggagtgttcggcgctg acgcagaagggcctgaagaccgtgtttgacgaggcgattcgcgccgtgctatgcccggtg cagcccatcaagggccggcggcggcattgtagtctcttctag

DBGET integrated database retrieval system