Bombyx mandarina (wild silkworm): 114242665 Help Entry 114242665         CDS       T05882                                  Name (RefSeq) ubiquitin-like protein 5   KO K13113   ubiquitin-like protein 5 Organism bman  Bombyx mandarina (wild silkworm) Brite KEGG Orthology (KO) [BR:bman00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03041 Spliceosome [BR:bman03041]     114242665   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:bman04052]     114242665 Spliceosome [BR:bman03041]  Complex B   Other components    Complex B specific factors     114242665 Cytokines and neuropeptides [BR:bman04052]  Neuropeptides   Unclassified    114242665 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  ubiquitin Ubiquitin_2 Crinkler PI3K_rbd OTU1_UBXL Rad60-SLD DUF5343 Motif Other DBs NCBI-GeneID:  114242665 NCBI-ProteinID:  XP_028029719 UniProt:  A0A6J2JN13 LinkDB All DBs Position Unknown AA seq 73 aa AA seqDB search MLEVTCNDRLGKKVRVKCNPDDTVGDLKKLIAAQTGTRYDKIVLKKWYTVFKDHIKLADY EIHDGMNLELYYQ NT seq 222 nt NT seq  +upstreamnt  +downstreamnt atgcttgaagtaacatgcaatgatcgactcggtaagaaggttcgagttaaatgcaaccct gacgataccgtgggtgatttaaagaagttaatagccgcacaaactggcactagatacgac aaaatagtactcaagaaatggtacacagtattcaaggatcatattaaacttgcagactat gaaatccacgatgggatgaatttggagctgtactatcaataa

DBGET integrated database retrieval system