Bombyx mandarina (wild silkworm): 114244428 Help Entry 114244428         CDS       T05882                                  Name (RefSeq) histone H2B   KO K11252   histone H2B Organism bman  Bombyx mandarina (wild silkworm) Brite KEGG Orthology (KO) [BR:bman00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:bman03036]     114244428   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:bman04147]     114244428 Chromosome and associated proteins [BR:bman03036]  Eukaryotic type   Nucleosome assembly factors    Histones     114244428 Exosome [BR:bman04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    114244428 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Histone CBFD_NFYB_HMF TFIID_20kDa DUF1931 Motif Other DBs NCBI-GeneID:  114244428 NCBI-ProteinID:  XP_028032039 UniProt:  A0A6J2JV04 LinkDB All DBs Position Unknown AA seq 67 aa AA seqDB search MSIMNSFVNDIFERIAAEASRLAHYNKRSTITSREVQTSVRLLLPGELAKHAVSEGTKAV TKYTSSK NT seq 204 nt NT seq  +upstreamnt  +downstreamnt atgtcgatcatgaattcgttcgtgaacgacatcttcgaacgtatcgctgcagaagcttct cgtctcgcccattacaacaagcgttcgacgataacctcgagggaggttcagacttcagtg agattgttgttaccgggtgaactcgccaagcacgcggtcagtgaaggaaccaaagccgtc acgaaatacacgagctccaagtaa

DBGET integrated database retrieval system