Bombyx mandarina (wild silkworm): 114245034 Help Entry 114245034         CDS       T05882                                  Name (RefSeq) synaptobrevin-1-like   KO K13504   vesicle-associated membrane protein 2 Organism bman  Bombyx mandarina (wild silkworm) Pathway bman04130   SNARE interactions in vesicular transport bman04145   Phagocytosis Brite KEGG Orthology (KO) [BR:bman00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04130 SNARE interactions in vesicular transport     114245034  09140 Cellular Processes   09141 Transport and catabolism    04145 Phagocytosis     114245034  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:bman04131]     114245034 Membrane trafficking [BR:bman04131]  SNARE   VAMP, Ykt6, Sec22 (R)    VAMP     114245034  Endoplasmic reticulum (ER) - Golgi transport   Forward pathways    Rab associated proteins     114245034 SSDB OrthologParalogGFIT Motif Pfam:  Synaptobrevin MCU SpoIIM Tuftelin_like SPC12 Motif Other DBs NCBI-GeneID:  114245034 NCBI-ProteinID:  XP_028032839 UniProt:  A0A6J2JXE3 LinkDB All DBs Position Unknown AA seq 120 aa AA seqDB search MEEQGGSSAPRVSDKRLAQTQAKVDEVVGIMRVNVEKVLERDQKLSELDNRADALQHGAA QFEQQAGKLKRKYWWQNLKMMLIIGAIGAVLLIIIIVWATSGSSSPAAPPVTEAPKDVGR NT seq 363 nt NT seq  +upstreamnt  +downstreamnt atggaagaacaaggaggaagttccgcaccaagagtaagcgacaaacgcttggcacaaaca caagccaaagtagatgaagttgttggcattatgcgtgtcaatgtcgagaaagttttggaa agagaccaaaaattgtcggaactagataatcgcgcagatgcgctgcaacatggggctgca cagtttgaacagcaagctggaaaacttaagcgcaagtattggtggcagaatttgaagatg atgttaattataggtgctattggtgcagtgttgcttattatcattattgtgtgggcaacg tccggttcgtcatcccctgccgcgcctccggtaactgaagcgcctaaagatgttggccga tag

DBGET integrated database retrieval system