Bombyx mandarina (wild silkworm): 114249651 Help Entry 114249651         CDS       T05882                                  Name (RefSeq) bombyxin B-8   KO K05459   insulin-like growth factor 1 Organism bman  Bombyx mandarina (wild silkworm) Pathway bman04068   FoxO signaling pathway bman04081   Hormone signaling bman04150   mTOR signaling pathway bman04213   Longevity regulating pathway - multiple species Brite KEGG Orthology (KO) [BR:bman00001]  09130 Environmental Information Processing   09132 Signal transduction    04068 FoxO signaling pathway     114249651    04150 mTOR signaling pathway     114249651   09133 Signaling molecules and interaction    04081 Hormone signaling     114249651  09150 Organismal Systems   09149 Aging    04213 Longevity regulating pathway - multiple species     114249651  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:bman04052]     114249651 Cytokines and neuropeptides [BR:bman04052]  Cytokines   Growth factors (RTK binding)    114249651 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Insulin Motif Other DBs NCBI-GeneID:  114249651 NCBI-ProteinID:  XP_028039090 UniProt:  A0A6J2KAZ5 LinkDB All DBs Position Unknown AA seq 88 aa AA seqDB search MKTSVVFVLIVLNLMWSGEAQEVARTYCGSHLADTLADLCFGVVKRGGAQYTPYFWQKAY LGSRGKRGVVDECCFRPCTLDVLASYCG NT seq 267 nt NT seq  +upstreamnt  +downstreamnt atgaagacttcagtagtttttgtattaatcgtgctgaacctgatgtggtcaggtgaggcc caggaggtagcgcgtacgtattgcggatctcacttggcggatacactcgccgacttgtgc ttcggagtggtgaaacgcggtggtgctcagtacacgccctacttctggcagaaggcatac ttgggatctcgcgggaaacgcggcgtagtggacgaatgctgtttccggccttgcacactt gacgttctcgcatcgtactgcggatag

DBGET integrated database retrieval system