KEGG   Bombyx mandarina (wild silkworm): 114251010
Entry
114251010         CDS       T05882                                 
Name
(RefSeq) cytochrome P450 306a1
  KO
K10720  ecdysteroid 25-hydroxylase [EC:1.14.-.-]
Organism
bman  Bombyx mandarina (wild silkworm)
Pathway
bman00981  Insect hormone biosynthesis
Brite
KEGG Orthology (KO) [BR:bman00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00981 Insect hormone biosynthesis
    114251010
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   00199 Cytochrome P450 [BR:bman00199]
    114251010
Enzymes [BR:bman01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.-
    1.14.-.-
     114251010
Cytochrome P450 [BR:bman00199]
 Cytochrome P450, animal type
  CYP306 family
   114251010
SSDB
Motif
Pfam: p450
Other DBs
NCBI-GeneID: 114251010
NCBI-ProteinID: XP_028040956
UniProt: A0A6J2KF40
LinkDB
Position
Unknown
AA seq 538 aa
MDLYFIWLVTFVAGFWIFKKIKEWQNLPPGPWGLPIVGYLPFIDRYHPHITLTNLSKTYG
AIYGLKMGSIYAVVLSDHKLVRDTFSKDSFSGRAPLYLTHGLMNGNGIICAEGGLWRDQR
KLITSWLKSFGMSKHSVSREKLEKRIASGVYEILENIEKTSDAALDLPHMLTNSLGNVVN
EIIFGFKFPPENKTWQWFRQIQEEGCHEMGVAGVVNFLPFIRHVSPSTRKTIEVLVRGQA
QTHTLYASMIDRRRKMLGLEKPKGAEYAPHENLLKLYPNGHIKCIKYSKVSPNTEHFFDP
NTLIPTEGDCILDNFLLEQKKRFESGDPTALYMRDEQLHFLLADMFGAGLDTTSVTLAWF
LLYMALFPEEQEEIRKEILSVYPYDDDVDSSRLPLLMAAICETQRIRSIVPVGIPHGCIE
DAYLGNYRIPKNAMVIPLQWAIHMDPNVWEEPEKFKPRRFLAQDGSLLKPQEFIPFQTGK
RMCPGDELSRMLSCGLVSRLFRKQRIRLASKIPTAEEMRGTVGVTLAPPPVKYYCEPI
NT seq 1617 nt   +upstreamnt  +downstreamnt
atggacctttattttatttggctggtaacgttcgtggctgggttttggattttcaaaaaa
ataaaggaatggcagaatttgccccccggaccttgggggttacctatcgtcggttatttg
cctttcattgatcgctatcatccacatatcaccttgacaaatttgtctaaaacatacgga
gctatttacggtctcaaaatgggcagcatatatgctgtagtgttatctgatcataaactt
gtaagagatacgttctcaaaagacagtttttctggacgagcacctctttacttaacacat
ggccttatgaatggaaatggaattatttgtgccgaaggcggtttgtggagggaccaaagg
aaattaataacatcgtggttgaaaagttttggaatgagtaagcacagtgtttcccgagaa
aaattggaaaaacgaatcgcttcaggagtatacgaaattttggaaaatatcgaaaaaact
tctgatgctgccttggaccttcctcatatgctgacgaattctttaggaaacgttgtcaat
gagataatattcggctttaagtttccacctgaaaataaaacatggcaatggtttcgtcaa
atacaggaggaaggatgccatgagatgggagtcgcaggtgttgtaaacttcttgcccttt
atacgccatgtttcgccatcaacacgaaaaacaattgaagttctagtccgtggacaggca
cagacgcatactttgtacgcaagcatgatagatagacgaagaaaaatgttgggcttagag
aagcctaagggagccgaatatgctcctcacgaaaaccttttaaaactatatccaaatggc
catatcaaatgcataaaatacagcaaagtctctccgaacaccgagcatttctttgatccc
aatactcttattccgactgaaggagattgcatactggataattttctgttggagcaaaag
aaacgatttgagagtggagacccaacggcactgtatatgagagatgaacagttacatttt
ctactagcggatatgttcggtgccggactggatactacatcggtgactttagcttggttt
ttgctatacatggctttgtttccagaagaacaggaagaaatacgtaaagaaatcttatcc
gtatatccatatgacgatgatgttgatagttcaaggttacctcttcttatggcagcaatc
tgtgaaactcagaggattcgatcgattgttccagtgggaataccccatggttgtatagag
gacgcttacttgggtaactacagaatcccaaaaaatgccatggtgatcccattgcagtgg
gctattcacatggatcctaatgtttgggaagaaccagaaaaattcaaaccgcgtagattt
ttggctcaggatggtagtctacttaagcctcaagaattcattccgtttcaaactggtaag
cggatgtgtccgggtgacgaactgtcccgtatgttgtcgtgtggcctcgtaagtagacta
ttcagaaagcagcgtattcgactcgcatcaaaaataccgacagcagaagagatgcgtgga
accgtcggtgttacgttggcacctcctccggtgaaatactattgcgaaccaatttaa

DBGET integrated database retrieval system