Bombyx mandarina (wild silkworm): 114252797 Help Entry 114252797         CDS       T05882                                  Name (RefSeq) centromere protein X-like   KO K15360   centromere protein X Organism bman  Bombyx mandarina (wild silkworm) Pathway bman03460   Fanconi anemia pathway Brite KEGG Orthology (KO) [BR:bman00001]  09120 Genetic Information Processing   09124 Replication and repair    03460 Fanconi anemia pathway     114252797  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03400 DNA repair and recombination proteins [BR:bman03400]     114252797 DNA repair and recombination proteins [BR:bman03400]  Eukaryotic type   DSBR (double strand breaks repair)    FA (Fanconi anemia) pathway     FA core complex binding factors      114252797 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  CENP-X TAFII28 TFIID-18kDa CBFD_NFYB_HMF RsmF-B_ferredox TIP49_C Motif Other DBs NCBI-GeneID:  114252797 NCBI-ProteinID:  XP_028043244 UniProt:  A0A6J2KST8 LinkDB All DBs Position Unknown AA seq 96 aa AA seqDB search MARNIKDNNNIDPATLLSNVKSTIKKDVIKELLENHFQESKTKIAPHALMLLADVAKCLV TETCLRAVKQAQREGSNKVDVEHIEKCLPQLMLDFP NT seq 291 nt NT seq  +upstreamnt  +downstreamnt atggcccgcaatattaaggacaataataatattgatccggctactttattgtctaatgtg aaaagtacaattaaaaaggatgtaataaaggaactattagaaaaccacttccaagaaagt aaaaccaagattgccccacatgctcttatgttgttggcagatgtggccaaatgtctggtc accgagacatgcctgcgtgcagtcaaacaagcacagagagagggttctaacaaagttgat gtagaacatattgagaaatgtttaccccagctgatgctggacttcccttaa

DBGET integrated database retrieval system