Burkholderia mallei BMQ: DM76_4045
Help
Entry
DM76_4045 CDS
T03490
Name
(GenBank) tyrosine kinase family protein
KO
K08282
non-specific serine/threonine protein kinase [EC:
2.7.11.1
]
Organism
bmaq
Burkholderia mallei BMQ
Brite
KEGG Orthology (KO) [BR:
bmaq00001
]
09190 Not Included in Pathway or Brite
09191 Unclassified: metabolism
99980 Enzymes with EC numbers
DM76_4045
Enzymes [BR:
bmaq01000
]
2. Transferases
2.7 Transferring phosphorus-containing groups
2.7.11 Protein-serine/threonine kinases
2.7.11.1 non-specific serine/threonine protein kinase
DM76_4045
BRITE hierarchy
SSDB
Ortholog
Paralog
Gene cluster
GFIT
Motif
Pfam:
Pkinase
PK_Tyr_Ser-Thr
ABC1
Kdo
PEGA
Haspin_kinase
Pkinase_fungal
Motif
Other DBs
NCBI-ProteinID:
AIO61011
UniProt:
A0AAX1XDY2
LinkDB
All DBs
Position
2:complement(1028263..1030860)
Genome browser
AA seq
865 aa
AA seq
DB search
MTDPFSRDNEQETVTRGGGAEFAVRPLPLGHRLGELQLDEVLGVGGFGIVYRAFDRTLRR
AVAIKEYMPSMLATRGGDYTVSLRSVRFAQAFDAGRSAFLNEARLLAQFDHPGLVKVLHF
WESHGTAYMVMPFYEGRTLKQLLDGGAQIGETQLRHIVAALLGALDTLHRAQCFHRDIAL
DNILIRPDGNPILLDFGAARKRIGDLVDDSAMMIKPGYAPIEQYTDDPAFSQGPWTDLYA
LGAVMHAMVTGELPPAAVVRSIQDTYRPLAARELTAREPYSPAFLAAIDHALQLKIADRP
ESVAEFAAELGLREFDRPPYVAPMPAGAPQPREARDAGAAEDDARRAAASGSPEARRRGD
ADVDADARPDGERARQPEQPPPARQSAAHRLGDSAQADGEGAGDESGAAAARWQGDDERA
DERPDESTDEPAARAERAMAAQSGAQPAQTPPPPQASERGAAATRSDADSGAPSPRPWAA
DGRDGESSGPRVDHMQSQSQSPPSRSREHAGERDPRPARPGVADASRQAAPASRDGGAPP
PEASGPRVSDAPVSRDAAGADAEAAMSAAAAGAGAPARAGASNASASSGAPAVCAASTAS
TASAASRSTAPAGPPGNARARLRDRRTIAYAGGALAVLVALGIGVAHLVKPSGRTEATAA
NALAPLSPAAPPVPGSVSALAQRGEPPPALAPPPAPADTAVREPAPSVATTTAGASATPT
TSPGAAPPPSAQIANHDAGAASAHGAQASNLAPNGSLDATETVVANPPAGAEPPVSPSVA
QEAAAAAEQRPPDMQETIPVRLHVRPWGDVYVSGVKRGASPPLRTLSLAPGVYQIEIRNG
TLPPLRRTVKIDPGSKPVSIDYAFE
NT seq
2598 nt
NT seq
+upstream
nt +downstream
nt
atgacggacccattttcgagagacaacgagcaggaaaccgtgacccgcggcggcggcgcc
gaattcgcggtgcggccgctgccgctcggccatcgcctcggcgaattgcaactggacgag
gtgctcggcgtcggcggcttcgggatcgtctatcgggcgttcgatcgcacgctgcggcgc
gcggtcgcgatcaaggaatacatgccgtcgatgctcgcgacgcgcggcggcgactacacg
gtttcgctgcgctcggtgcgcttcgcgcaggcgttcgacgcgggccgcagcgcgtttctc
aacgaggcgcggctgctcgcgcaattcgatcatccggggctcgtcaaggtcctgcatttc
tgggagagccacggcaccgcgtacatggtgatgccgttctacgaagggcgcacgctcaag
caactgctcgacggcggcgcgcagatcggcgagacgcagctccgccacatcgtcgccgcg
ctgctcggcgcgctcgacacgctgcatcgcgcgcagtgcttccatcgcgacatcgcgctc
gacaacatcctgatccggcccgacggcaatccgatcctgctcgacttcggcgcggcgcgc
aaacggatcggcgatctcgtcgacgacagcgcgatgatgatcaagccgggctatgcgccg
atcgagcagtacaccgacgatccggccttcagccaggggccttggaccgatctgtacgca
ctcggcgcggtgatgcatgcgatggtcacgggcgagctgccgcccgcggcggtcgtgcgc
agcatccaggatacctatcggccgctcgccgcgcgcgagttgaccgcgcgtgagccgtac
agtccggcgtttctcgcggcgatcgaccacgcgttgcaactgaagatcgccgacaggccg
gagtcggtcgcggagttcgcggcggagctcgggttgcgcgagttcgatcggccgccttac
gtcgcgccgatgccggcgggcgcgccgcagccgcgggaggcgcgcgacgcgggcgcggcg
gaagacgacgcgcggcgcgcggcggcgtccgggtcgccggaggcgcggcgacgtggcgat
gcggatgtggatgcggatgcgcggcccgacggggagcgggcgcggcagccggagcagccg
ccaccggcgcggcagtcggctgcgcatcggcttggcgattcggcacaggcggacggagaa
ggggccggtgacgaatcgggtgcggcggcggcgcgttggcagggcgatgacgagcgcgcg
gatgaacggccggatgaatcgaccgatgaaccggccgcacgcgcggaacgagcgatggcg
gcgcagagcggcgcgcaaccagcgcagacgcccccgcctcctcaggcgagcgagcgcggc
gcggccgcgacgcgatcggacgcggattccggcgcgccgtcgccgcggccgtgggccgcc
gacggtcgcgatggcgaatcttccgggccgcgcgtcgatcatatgcagtcgcagtcgcag
tcgccgccgtcacgatcgcgcgagcacgcgggcgagcgcgatccgcggccggcgcgaccg
ggcgtagccgacgcgtcgcggcaagcggcgcctgcgtcgcgagacggcggtgcgccgccg
cccgaagcgagcggccctcgggtatccgatgcgccggtctcgcgcgatgcggcgggcgct
gacgcggaggcggccatgagcgcggcggcggccggggcgggagcgcccgcccgcgccggc
gcgtcgaacgcgtccgcatcgtctggcgcgcccgccgtctgcgctgcgtcgactgcctcc
acggcctccgcggcatcgcgctccaccgcgcccgccgggccgcccggcaacgcgcgcgcg
cggctgcgcgaccggcggacgatcgcctatgcgggcggcgcgcttgcggtgttggtcgcg
cttggcatcggcgtcgcgcacctcgtgaagccgtccggccgcaccgaagcgacggcggcg
aacgcgctcgcgccgctgtcgcccgccgcgccgcccgtgcccggcagcgtctccgcgctc
gcgcagcgcggcgagccgccgcccgcgctcgcgccgccgcccgcgcctgccgatacggcc
gtgcgcgagcccgcgccgagcgtcgcgacgacgacggccggcgcgagcgccacgccgacg
acgtcgccgggcgccgcgccgccgccttcggcacagatcgcgaaccacgacgcgggcgcc
gcgtccgcgcacggcgcgcaggcgtcgaacctcgcgccgaatggcagcctcgacgcgacg
gaaacggtggtcgcgaatccgccggcgggcgccgagccgcccgtgtcgccgtccgtcgcg
caggaagccgccgccgcggccgagcagcggccgccggacatgcaggagacgatccccgtg
cgcttgcacgtgcgcccgtggggcgacgtgtacgtgagcggcgtgaagcgcggcgcgagt
ccgccgctgcggacgctgtcgctcgcgccgggcgtctatcagatcgagattcgcaacggc
acgctgccgccgctgcgacgcaccgtgaagatcgatccgggcagcaagccggtgagtatc
gactatgcgttcgaatga
DBGET
integrated database retrieval system