Bermanella marisrubri: HF888_09685 Help Entry HF888_09685       CDS       T06527                                  Symbol acpP Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism bmar  Bermanella marisrubri Pathway bmar01100   Metabolic pathways bmar01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:bmar00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     HF888_09685 (acpP)    00074 Mycolic acid biosynthesis     HF888_09685 (acpP)   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     HF888_09685 (acpP) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 DUF7080 DUF6137 DIMCO_N DUF1493 Motif Other DBs NCBI-ProteinID:  QIZ84478 LinkDB All DBs Position complement(2085212..2085451) Genome browser AA seq 79 aa AA seqDB search MSDIYNQVVEVVVEQLGVEVDQVKMESHFIEDLGADSLDTVELLMALEEKFDCEIEEDKA EKLTTVKDIVEFVQSLETA NT seq 240 nt NT seq  +upstreamnt  +downstreamnt atgtccgatatttataatcaagtagtagaagttgtcgtagagcaactcggcgtagaagta gaccaagtgaaaatggaatcacatttcattgaagatttgggtgcagattcattggatact gttgagttgttgatggctttagaagaaaaattcgattgcgaaatcgaagaagacaaagct gaaaaattaacgactgtaaaagatattgtcgagtttgttcagtcgctagagactgcataa

DBGET integrated database retrieval system