Bermanella marisrubri: HF888_14635 Help Entry HF888_14635       CDS       T06527                                  Symbol hfq Name (GenBank) RNA chaperone Hfq   KO K03666   host factor-I protein Organism bmar  Bermanella marisrubri Pathway bmar02024   Quorum sensing bmar03018   RNA degradation Brite KEGG Orthology (KO) [BR:bmar00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    03018 RNA degradation     HF888_14635 (hfq)  09140 Cellular Processes   09145 Cellular community - prokaryotes    02024 Quorum sensing     HF888_14635 (hfq)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03019 Messenger RNA biogenesis [BR:bmar03019]     HF888_14635 (hfq)    03036 Chromosome and associated proteins [BR:bmar03036]     HF888_14635 (hfq) Messenger RNA biogenesis [BR:bmar03019]  Prokaryotic type   Bacterial mRNA degradation factors    Other RNA degradation factors     Chaperones      HF888_14635 (hfq) Chromosome and associated proteins [BR:bmar03036]  Prokaryotic type   Nucleoid associated proteins    Other nucleoid associated proteins     HF888_14635 (hfq) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Hfq LSM Hfq_1 Motif Other DBs NCBI-ProteinID:  QIZ85381 LinkDB All DBs Position complement(3144998..3145243) Genome browser AA seq 81 aa AA seqDB search MSKGHSLQDPYLNALRKERISVSIFLVNGIKLQGHIESFDQFVIVLKNTVSQMVYKHAIS TVVPSRNVRLAPPEKDDDSAE NT seq 246 nt NT seq  +upstreamnt  +downstreamnt atgtcaaaagggcactccctacaagacccttatttgaacgcgctgcgcaaagagcgtatt tcagtgtcgatctttttagttaatggtatcaagctgcaaggacatattgagtcttttgat cagtttgtgattgttttgaaaaataccgtaagccagatggtgtataagcacgcgatttct accgtggtgccatctcgcaatgtgcgtttggcgccgcctgaaaaagacgacgacagcgca gagtaa

DBGET integrated database retrieval system