Blautia massiliensis: LK422_06570 Help Entry LK422_06570       CDS       T08787                                  Name (Genbank) acyl carrier protein   KO K02078   acyl carrier protein Organism bmas  Blautia massiliensis Pathway bmas01100   Metabolic pathways bmas01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:bmas00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     LK422_06570   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     LK422_06570 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 Motif Other DBs NCBI-ProteinID:  UEA30021 LinkDB All DBs Position 1387870..1388118 Genome browser AA seq 82 aa AA seqDB search MELEMLKTIIEKTLGRNMDAITEKTTFVDDLGVDSLDFFQILIDLEETFDVRIAPEEAEE IVTVGDAVETLRRVTKGRRNGK NT seq 249 nt NT seq  +upstreamnt  +downstreamnt gtggaactggaaatgctgaagaccatcatcgaaaaaactctgggaagaaatatggatgcc attacagaaaaaactacctttgtggatgatctgggagtggattctctggatttttttcag attcttattgatctggaggaaacttttgatgttcgtatcgccccggaggaagccgaggag atcgttactgtcggcgatgcagtggagactcttcgccgagtaacgaagggaagaagaaat ggaaaataa

DBGET integrated database retrieval system