Burkholderia mallei NCTC 10247: BM44_3590 Help Entry BM44_3590         CDS       T03524                                  Name (GenBank) H-NS histone family protein   KO K03746   DNA-binding protein H-NS Organism bmaz  Burkholderia mallei NCTC 10247 Brite KEGG Orthology (KO) [BR:bmaz00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:bmaz03036]     BM44_3590    03400 DNA repair and recombination proteins [BR:bmaz03400]     BM44_3590 Chromosome and associated proteins [BR:bmaz03036]  Prokaryotic type   Nucleoid associated proteins    HNS (histone-like nucleoid structuring protein)     BM44_3590 DNA repair and recombination proteins [BR:bmaz03400]  Prokaryotic type   DSBR (double strand breaks repair)    NHEJ (non-homologous end-joining)     SHDIR (short-homology-dependent illegitimate recombination)      Supressor       BM44_3590 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Histone_HNS Motif Other DBs NCBI-ProteinID:  AIS26509 LinkDB All DBs Position 2:535291..535590 Genome browser AA seq 99 aa AA seqDB search MSTYLELKAKADEILRQAEEARRSELETVLKEVRTRVAEYGLTPEQVFGARRGRRGQQVH ASPTVPKYRDPKTGATWSGRGREPGWIKGKKRERFLIQQ NT seq 300 nt NT seq  +upstreamnt  +downstreamnt atgagtacttatctcgaattgaaagccaaagccgatgagatcctgcgtcaggcagaagaa gcgagacgctcggaactcgagacggtcttgaaggaagttcgcacgcgcgtcgcggaatac ggattgacgccggaacaggtattcggcgcgcgccgcgggcgacgcggccaacaggtgcat gccagtccgacggttcccaaataccgcgacccgaaaacgggggcgacctggagcggccgg gggcgcgaaccgggctggatcaagggcaagaaacgcgagcgcttcctgattcagcagtaa

DBGET integrated database retrieval system