Brucella abortus bv. 1 9-941: BruAb2_0710 Help Entry BruAb2_0710       CDS       T00241                                  Symbol ybgT Name (GenBank) YbgT   KO K00424   cytochrome bd-I ubiquinol oxidase subunit X [EC:7.1.1.7] Organism bmb  Brucella abortus bv. 1 9-941 Pathway bmb00190   Oxidative phosphorylation bmb01100   Metabolic pathways bmb02020   Two-component system Module bmb_M00153   Cytochrome bd ubiquinol oxidase Brite KEGG Orthology (KO) [BR:bmb00001]  09100 Metabolism   09102 Energy metabolism    00190 Oxidative phosphorylation     BruAb2_0710 (ybgT)  09130 Environmental Information Processing   09132 Signal transduction    02020 Two-component system     BruAb2_0710 (ybgT) Enzymes [BR:bmb01000]  7. Translocases   7.1  Catalysing the translocation of protons    7.1.1  Linked to oxidoreductase reactions     7.1.1.7  quinol oxidase (electrogenic, proton-motive force generating)      BruAb2_0710 (ybgT) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  YbgT_YccB Hemotin Motif Other DBs NCBI-ProteinID:  AAX76116 UniProt:  Q577R8 LinkDB All DBs Position II:complement(722252..722407) Genome browser AA seq 51 aa AA seqDB search MWYFSWLLGLPLAAAFAVLNAMWYELMDDRARKRLAADPTAELALEGNKHH NT seq 156 nt NT seq  +upstreamnt  +downstreamnt atgtggtatttttcctggcttttgggcctgccgcttgcagccgcgttcgctgtgctaaat gcgatgtggtatgagctgatggacgaccgggcgcgcaagcgccttgccgccgaccccacg gcggaactggcccttgaaggcaacaagcaccactga

DBGET integrated database retrieval system