Brucella abortus S19: BAbS19_I19400
Help
Entry
BAbS19_I19400 CDS
T00703
Name
(GenBank) DNA polymerase III, epsilon subunit
KO
K02342
DNA polymerase III subunit epsilon [EC:
2.7.7.7
]
Organism
bmc
Brucella abortus S19
Pathway
bmc03030
DNA replication
bmc03430
Mismatch repair
bmc03440
Homologous recombination
Brite
KEGG Orthology (KO) [BR:
bmc00001
]
09120 Genetic Information Processing
09124 Replication and repair
03030 DNA replication
BAbS19_I19400
03430 Mismatch repair
BAbS19_I19400
03440 Homologous recombination
BAbS19_I19400
09180 Brite Hierarchies
09182 Protein families: genetic information processing
03032 DNA replication proteins [BR:
bmc03032
]
BAbS19_I19400
03400 DNA repair and recombination proteins [BR:
bmc03400
]
BAbS19_I19400
Enzymes [BR:
bmc01000
]
2. Transferases
2.7 Transferring phosphorus-containing groups
2.7.7 Nucleotidyltransferases
2.7.7.7 DNA-directed DNA polymerase
BAbS19_I19400
DNA replication proteins [BR:
bmc03032
]
Prokaryotic type
DNA Replication Elongation Factors
Elongation factors (bacterial)
DNA polymerase III holoenzyme
BAbS19_I19400
DNA repair and recombination proteins [BR:
bmc03400
]
Prokaryotic type
SSBR (single strand breaks repair)
MMR (mismatch excision repair)
DNA polymerase III holoenzyme
BAbS19_I19400
BRITE hierarchy
SSDB
Ortholog
Paralog
Gene cluster
GFIT
Motif
Pfam:
RNase_T
RNase_H_2
DNA_pol_A_exo1
DEDDh_C
Motif
Other DBs
NCBI-ProteinID:
ACD73422
UniProt:
A0A0F6AT13
LinkDB
All DBs
Position
1:2012195..2012899
Genome browser
AA seq
234 aa
AA seq
DB search
MREIVFDTETTGLERLEDRVIEIGGVELVNRFPTGRTFHKFINPQGRQVHPDALAVHGIS
NEQLLDKPVFAEILDEFLEFIDGARLVAHNAMFDLGFINAELARLDQAEITSEHIVDTLA
LARRKHPMGPNSLDALCKRYGIDNSHRTLHGALLDAQILAEVYIELIGGKQTALGLTMES
GSAGGDSRGNGSAPVVLAARPRPLPPRISDAERAAHAALVEKMGDKAVWKKYLS
NT seq
705 nt
NT seq
+upstream
nt +downstream
nt
atgcgcgaaatcgtttttgatacggaaaccaccggcctggaacggctggaggaccgcgtg
atcgaaattggcggtgtggaacttgttaaccggtttcctacaggccgcaccttccataaa
ttcatcaatccgcaggggcgtcaagttcatcccgatgcgctcgccgttcatggcatcagc
aacgaacaattgctggacaaaccggtttttgcggaaattctggacgagtttctggaattc
atcgacggggccaggcttgttgcgcataacgccatgttcgaccttggcttcatcaatgcg
gaacttgcgcggctagaccaggccgagatcacttcggaacatatcgtggatacgctggcg
ctcgcccgtcgcaaacacccgatggggccgaactcgctggatgcgctctgcaagcgttat
ggtatcgacaattcgcaccgcaccctgcacggcgcattgctcgacgcgcagattctggct
gaagtctatatcgaattgatcggcggcaagcagaccgcacttggcctgaccatggaaagc
ggttctgctggcggtgacagtcgcggcaatggcagcgcacccgttgtcctggccgcccgc
cctcgcccgttgccgccgcgcatttcggatgcggaacgtgcggcccatgccgcactggtg
gagaaaatgggcgacaaggctgtctggaagaaatatctatcctga
DBGET
integrated database retrieval system