Brucella melitensis bv. 1 16M: BMEI0226 Help Entry BMEI0226          CDS       T00072                                  Name (GenBank) chorismate mutase   KO K04092   chorismate mutase [EC:5.4.99.5] Organism bme  Brucella melitensis bv. 1 16M Pathway bme00400   Phenylalanine, tyrosine and tryptophan biosynthesis bme01100   Metabolic pathways bme01110   Biosynthesis of secondary metabolites bme01230   Biosynthesis of amino acids Brite KEGG Orthology (KO) [BR:bme00001]  09100 Metabolism   09105 Amino acid metabolism    00400 Phenylalanine, tyrosine and tryptophan biosynthesis     BMEI0226 Enzymes [BR:bme01000]  5. Isomerases   5.4  Intramolecular transferases    5.4.99  Transferring other groups     5.4.99.5  chorismate mutase      BMEI0226 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  CM_2 Motif Other DBs NCBI-ProteinID:  AAL51408 UniProt:  Q8YJ60 LinkDB All DBs Position I:230983..231264 Genome browser AA seq 93 aa AA seqDB search MSNEQNTIPAELLALRASIDNIDAALIHMLAERFRCTKAVGVLKAERGLAPADPAREKRQ VARLRALAADANLDPDFAEKFLNFIVQGSHSAS NT seq 282 nt NT seq  +upstreamnt  +downstreamnt atgagcaacgagcagaacaccatacccgctgagcttctggcgctgcgtgcatcgatcgac aatatcgacgctgccctcattcatatgttggccgaacgctttcgctgcacgaaggctgtc ggcgtattgaaggccgagcgaggtctggcaccggctgatccggcccgcgagaagcgccag gtggcgcggctgcgcgcgctggccgcagatgccaatctcgatcccgattttgctgaaaag ttcctgaactttatcgtgcaaggaagtcattcggcatcatga

DBGET integrated database retrieval system