Brucella melitensis bv. 1 16M: BMEI1149
Help
Entry
BMEI1149 CDS
T00072
Name
(GenBank) NADH-quinone oxidoreductase chain j
KO
K00339
NADH-quinone oxidoreductase subunit J [EC:
7.1.1.2
]
Organism
bme
Brucella melitensis bv. 1 16M
Pathway
bme00190
Oxidative phosphorylation
bme01100
Metabolic pathways
Module
bme_M00144
NADH:quinone oxidoreductase, prokaryotes
Brite
KEGG Orthology (KO) [BR:
bme00001
]
09100 Metabolism
09102 Energy metabolism
00190 Oxidative phosphorylation
BMEI1149
Enzymes [BR:
bme01000
]
7. Translocases
7.1 Catalysing the translocation of protons
7.1.1 Linked to oxidoreductase reactions
7.1.1.2 NADH:ubiquinone reductase (H+-translocating)
BMEI1149
BRITE hierarchy
SSDB
Ortholog
Paralog
Gene cluster
GFIT
Motif
Pfam:
Oxidored_q3
DUF6479
T4SS_CagC
DUF2231
Motif
Other DBs
NCBI-ProteinID:
AAL52330
UniProt:
Q8YGK9
LinkDB
All DBs
Position
I:complement(1196813..1197382)
Genome browser
AA seq
189 aa
AA seq
DB search
MIASAFMVIAARNPVHSVLFLILTFFNAAALFLLTGAEFLAMILLVVYVGAVAVLFLFVV
MMLDVDFAELKRGALQYAPVGALVGLILLGELIFVFASRMFTPKLGQGALPIPDVATRTN
TAALGDILYTHYVFYFQVAGLVLLVAMIGAIVLTMRHKPNVKRQSIPAQVARTPETAIEI
RKVETGKGI
NT seq
570 nt
NT seq
+upstream
nt +downstream
nt
atgatcgccagcgcgttcatggtgattgcggcgcgcaaccccgtgcattcggtgctgttt
ctgatcctcacattcttcaatgcggcggcgctcttcctgctgacgggggctgagttcctt
gccatgatcctgcttgtcgtttacgtcggcgcggtggcggttctcttcctcttcgtcgtc
atgatgctggatgtggactttgctgaactgaagcgcggtgcactgcaatatgcgccggtc
ggcgctctggtcggattgatccttctgggcgaactgatcttcgttttcgcaagccgcatg
ttcacgccgaagctggggcagggtgccttgccgatcccggatgttgccacgcggaccaat
accgctgccctcggcgacattctctacacccactacgttttctacttccaggtcgcaggt
ctcgttcttctggtcgcgatgatcggcgccattgtgctgacgatgcggcacaagccgaat
gtcaagcgccagtccatcccggctcaggttgctcgtacgcccgaaacggcgatcgagatc
agaaaagtcgaaacgggcaaaggcatctga
DBGET
integrated database retrieval system