Brucella melitensis bv. 1 16M: BMEII0744 Help Entry BMEII0744         CDS       T00072                                  Name (GenBank) dihydrolipoamide dehydrogenase   KO K00382   dihydrolipoyl dehydrogenase [EC:1.8.1.4] Organism bme  Brucella melitensis bv. 1 16M Pathway bme00010   Glycolysis / Gluconeogenesis bme00020   Citrate cycle (TCA cycle) bme00260   Glycine, serine and threonine metabolism bme00280   Valine, leucine and isoleucine degradation bme00310   Lysine degradation bme00380   Tryptophan metabolism bme00620   Pyruvate metabolism bme00630   Glyoxylate and dicarboxylate metabolism bme00640   Propanoate metabolism bme00670   One carbon pool by folate bme00785   Lipoic acid metabolism bme01100   Metabolic pathways bme01110   Biosynthesis of secondary metabolites bme01120   Microbial metabolism in diverse environments bme01200   Carbon metabolism bme01210   2-Oxocarboxylic acid metabolism bme01240   Biosynthesis of cofactors Module bme_M00009   Citrate cycle (TCA cycle, Krebs cycle) bme_M00011   Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate bme_M00036   Leucine degradation, leucine => acetoacetate + acetyl-CoA bme_M00307   Pyruvate oxidation, pyruvate => acetyl-CoA bme_M00621   Glycine cleavage system Brite KEGG Orthology (KO) [BR:bme00001]  09100 Metabolism   09101 Carbohydrate metabolism    00010 Glycolysis / Gluconeogenesis     BMEII0744    00020 Citrate cycle (TCA cycle)     BMEII0744    00620 Pyruvate metabolism     BMEII0744    00630 Glyoxylate and dicarboxylate metabolism     BMEII0744    00640 Propanoate metabolism     BMEII0744   09105 Amino acid metabolism    00260 Glycine, serine and threonine metabolism     BMEII0744    00280 Valine, leucine and isoleucine degradation     BMEII0744    00310 Lysine degradation     BMEII0744    00380 Tryptophan metabolism     BMEII0744   09108 Metabolism of cofactors and vitamins    00785 Lipoic acid metabolism     BMEII0744    00670 One carbon pool by folate     BMEII0744  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:bme04147]     BMEII0744 Enzymes [BR:bme01000]  1. Oxidoreductases   1.8  Acting on a sulfur group of donors    1.8.1  With NAD+ or NADP+ as acceptor     1.8.1.4  dihydrolipoyl dehydrogenase      BMEII0744 Exosome [BR:bme04147]  Exosomal proteins   Exosomal proteins of breast cancer cells    BMEII0744 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Pyr_redox_dim AlkA_N Motif Other DBs NCBI-ProteinID:  AAL53986 UniProt:  Q8YBZ2 LinkDB All DBs Position II:complement(783013..783342) Genome browser AA seq 109 aa AA seqDB search MTVGLSLDEARKAGHNIQTGLFPFQANGRAMTMERDDGIVRVVARADNHVILGIQAVGAG ISELSAAFAQAVEMGARLEDIAATIHAHPTLGEGFAEASMKALGHALHV NT seq 330 nt NT seq  +upstreamnt  +downstreamnt gtgaccgttggcctttcgctcgatgaagcgcgcaaggccgggcataatatccagactggc cttttcccgtttcaggccaatggccgcgccatgacgatggaacgcgatgatggcatagtg cgcgtggttgcccgcgcggacaatcacgtcatcttgggcattcaggcagtcggagccggt atttcggaactgtcggcagcttttgctcaggcggtggaaatgggtgcacgtctggaagat atcgccgcaacgatccatgcccacccgaccttgggcgaaggctttgccgaggccagcatg aaggcgcttggccacgctctacatgtttga

DBGET integrated database retrieval system