Brucella melitensis bv. 1 16M: BMEII0758 Help Entry BMEII0758         CDS       T00072                                  Name (GenBank) protein ybgt   KO K00424   cytochrome bd-I ubiquinol oxidase subunit X [EC:7.1.1.7] Organism bme  Brucella melitensis bv. 1 16M Pathway bme00190   Oxidative phosphorylation bme01100   Metabolic pathways bme02020   Two-component system Module bme_M00153   Cytochrome bd ubiquinol oxidase Brite KEGG Orthology (KO) [BR:bme00001]  09100 Metabolism   09102 Energy metabolism    00190 Oxidative phosphorylation     BMEII0758  09130 Environmental Information Processing   09132 Signal transduction    02020 Two-component system     BMEII0758 Enzymes [BR:bme01000]  7. Translocases   7.1  Catalysing the translocation of protons    7.1.1  Linked to oxidoreductase reactions     7.1.1.7  quinol oxidase (electrogenic, proton-motive force generating)      BMEII0758 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  YbgT_YccB Hemotin Motif Other DBs NCBI-ProteinID:  AAL54000 UniProt:  Q8YBX8 LinkDB All DBs Position II:complement(796241..796396) Genome browser AA seq 51 aa AA seqDB search MWYFSWLLGLPLAAAFAVLNAMWYELMDDRARKRLAADPTAELALEGNKHH NT seq 156 nt NT seq  +upstreamnt  +downstreamnt atgtggtatttttcctggcttttgggcctgccgcttgcagccgcgttcgctgtgctgaat gcgatgtggtatgagctgatggacgaccgggcgcgcaagcgccttgccgccgaccccacg gcggaactggcccttgaaggcaacaagcaccactga

DBGET integrated database retrieval system