Brucella melitensis bv. 1 16M: BMEII0907 Help Entry BMEII0907         CDS       T00072                                  Name (GenBank) glutaminase   KO K01425   glutaminase [EC:3.5.1.2] Organism bme  Brucella melitensis bv. 1 16M Pathway bme00220   Arginine biosynthesis bme00250   Alanine, aspartate and glutamate metabolism bme00470   D-Amino acid metabolism bme01100   Metabolic pathways bme01110   Biosynthesis of secondary metabolites bme02020   Two-component system Brite KEGG Orthology (KO) [BR:bme00001]  09100 Metabolism   09105 Amino acid metabolism    00250 Alanine, aspartate and glutamate metabolism     BMEII0907    00220 Arginine biosynthesis     BMEII0907   09106 Metabolism of other amino acids    00470 D-Amino acid metabolism     BMEII0907  09130 Environmental Information Processing   09132 Signal transduction    02020 Two-component system     BMEII0907 Enzymes [BR:bme01000]  3. Hydrolases   3.5  Acting on carbon-nitrogen bonds, other than peptide bonds    3.5.1  In linear amides     3.5.1.2  glutaminase      BMEII0907 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Glutaminase Motif Other DBs NCBI-ProteinID:  AAL54149 UniProt:  Q8YBJ3 LinkDB All DBs Position II:complement(948566..948961) Genome browser AA seq 131 aa AA seqDB search MEAVDIYTRQCSTLVTATDLATMGATLAAGGVNPISGKRMVSAGNVAPILAEMTMEGLYT ALGDWAYTVGLPGKSGVGGGIMAVVPGELAIAAFSPPLDPAGNSVKAMAAVAAVADSLGH NLYTTRGKVSS NT seq 396 nt NT seq  +upstreamnt  +downstreamnt atggaggccgtggatatttatacgcgccaatgttcaacgcttgtaaccgcgaccgacctt gccacgatgggggcaacccttgccgccggcggtgttaatccgatcagcgggaagcgcatg gtttcggcaggcaatgttgccccaattctggccgaaatgaccatggaaggcctttatacg gctttaggcgattgggcttatacggtcggcctacccggtaaaagcggtgtcggtggtggc atcatggcggtagtgccgggtgagctggcaattgccgcgttttcaccgccgcttgatcca gccggaaatagtgtgaaagcaatggctgctgttgccgcagtggcagattcacttggccat aatctttataccaccagagggaaagtgtcatcctga

DBGET integrated database retrieval system