KEGG   Burkholderia metallica: WJ16_01840
Entry
WJ16_01840        CDS       T04871                                 
Name
(GenBank) ubiquinol-cytochrome c reductase iron-sulfur subunit
  KO
K00411  ubiquinol-cytochrome c reductase iron-sulfur subunit [EC:7.1.1.8]
Organism
bmec  Burkholderia metallica
Pathway
bmec00190  Oxidative phosphorylation
bmec01100  Metabolic pathways
bmec02020  Two-component system
Module
bmec_M00151  Cytochrome bc1 complex respiratory unit
Brite
KEGG Orthology (KO) [BR:bmec00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    WJ16_01840
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    WJ16_01840
 09140 Cellular Processes
  09141 Transport and catabolism
   04148 Efferocytosis
    WJ16_01840
Enzymes [BR:bmec01000]
 7. Translocases
  7.1  Catalysing the translocation of protons
   7.1.1  Linked to oxidoreductase reactions
    7.1.1.8  quinol---cytochrome-c reductase
     WJ16_01840
SSDB
Motif
Pfam: Rieske UCR_Fe-S_N
Other DBs
NCBI-ProteinID: AOJ30339
UniProt: A0ABT8PLS5
LinkDB
Position
1:399710..400330
AA seq 206 aa
MRDKEEKRVDSGRRTWLIATSVAGGVGGVATVIPFAASLAPSAKAKAAGAPVEVDISGLK
PGEMVTVPWRGKPVWILNRTDAMLADVVKADKEVADPTTEKPYTMPLPAYCANEYRSRAD
RKNILVVMAVCTHLGCTPSQRFTPGPQPNLPDDWPGGFLCPCHGSTYDLAGRVFKNKPAP
QNLDIPPYMFTSATTLVIGKDEKGEA
NT seq 621 nt   +upstreamnt  +downstreamnt
atgcgagacaaggaagagaaacgcgtcgacagcggccgccgtacctggctgattgcgaca
tccgtagcaggtggcgtgggaggcgtagccaccgtcatacctttcgcggcgtcgcttgcg
ccgtccgcgaaagcgaaagcggccggtgcaccggtcgaagtggacatcagcgggctgaag
cccggtgaaatggtgaccgtgccgtggcgcggcaagccggtgtggatcctgaaccgcacc
gacgcgatgctggccgatgtggtcaaggccgacaaggaagtggccgaccccaccaccgaa
aagccctacacgatgccgttgcccgcgtattgcgcgaacgaatatcgctcgcgggccgat
cgcaagaacatcctcgtcgtgatggccgtgtgcacgcacctcggctgcacgccaagccaa
cgcttcacgccgggtccgcagccgaacctgccggacgactggccgggcggtttcctctgc
ccgtgtcacggttcgacctacgacctcgccggccgtgtgttcaagaacaagccggcgcct
cagaatctcgacatcccgccctacatgttcacgtcggcaacgaccctcgtgatcggcaag
gacgagaaaggagaagcgtga

DBGET integrated database retrieval system