KEGG   Burkholderia metallica: WJ16_09495
Entry
WJ16_09495        CDS       T04871                                 
Name
(GenBank) threonine synthase
  KO
K01733  threonine synthase [EC:4.2.3.1]
Organism
bmec  Burkholderia metallica
Pathway
bmec00260  Glycine, serine and threonine metabolism
bmec00750  Vitamin B6 metabolism
bmec01100  Metabolic pathways
bmec01110  Biosynthesis of secondary metabolites
bmec01120  Microbial metabolism in diverse environments
bmec01230  Biosynthesis of amino acids
Module
bmec_M00018  Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:bmec00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    WJ16_09495
  09108 Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    WJ16_09495
Enzymes [BR:bmec01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     WJ16_09495
SSDB
Motif
Pfam: Thr_synth_N PALP THR4_C
Other DBs
NCBI-ProteinID: AOJ31728
UniProt: A0ABT8P9J3
LinkDB
Position
1:complement(2125083..2126534)
AA seq 483 aa
MNYISTRGAGIGERHTFSDILLGGLAKDGGLYLPAEYPKVSADELARWRTLPYADLAFEI
LSKFCDDVPADDLRAITRRTYTAAVYSNTRHGENAADITPLKTLGTENGAPISLLELSNG
PTLAFKDMAMQLLGNLFEYTLAKHGQTLNILGATSGDTGSAAEYAMRGKAGVRVFMLSPH
KKMSAFQTAQMFSLQDPNIFNLAVEGVFDDCQDIVKAVSNDHAFKAQQKIGTVNSINWAR
VVAQVVYYFKGYFAATKSNDERVSFTVPSGNFGNVCAGHIARMMGLPIAKLVVATNENDV
LDEFFRTGAYRVRSAENTYHTSSPSMDISKASNFERFVFDLLGRDPARVMQLFRDVEEKG
GFDLAASGDFARVAEFGFVSGRSSHTDRIATIRDVFSRYDTMIDTHTADGVKVAREHLDA
GVPMVVLETAQPIKFGETIREALDREAERPAAFDGLEALPQRFEVVKADAQQVKDFIAAH
TGA
NT seq 1452 nt   +upstreamnt  +downstreamnt
atgaactacatttccacgcgcggcgccggcatcggcgagcgccacacgttctccgacatc
ctgctcggcggtctcgcgaaggacggcgggctctacctgccggctgagtatccgaaggtg
tccgccgacgagctcgcgcgctggcgcacgctgccgtacgcggatctcgcgttcgagatc
ctgtcgaagttctgcgacgacgtgccggccgacgacctgcgcgcgatcacgcgccgcacg
tacacggccgccgtgtacagcaacacgcgccatggcgaaaacgcagccgacatcacgccg
ctgaagacgctcggcaccgagaacggcgcgccgatctcgctgctcgaactgtcgaacggc
ccgacgctcgcgttcaaggacatggcgatgcagctgctcggcaacctgttcgagtacacg
ctcgcgaagcacgggcagacgctgaacattctcggcgcgacgtccggcgacaccggcagc
gcggccgaatacgcgatgcgcggcaaggccggcgtgcgcgtgttcatgctgtcgccgcac
aagaagatgagcgcgttccagacggcgcagatgttcagcctgcaggacccgaacatcttc
aacctcgcggtcgaaggcgtgttcgacgattgccaggacatcgtgaaggcggtgtcgaac
gatcacgcgttcaaggcgcagcagaagatcggcacggtcaactcgatcaactgggcgcgg
gtcgtcgcgcaggtcgtgtactacttcaagggctatttcgcggcgacgaagtccaacgac
gaacgcgtatcgttcacggtgccgtcgggcaacttcggcaacgtgtgcgcagggcacatc
gcgcggatgatggggctgccgatcgcgaagctcgtggtcgcgaccaacgagaacgacgtg
ctcgacgagttcttccgcaccggcgcgtatcgcgtgcgcagcgccgagaacacctatcac
acgagcagcccgagcatggacatctcgaaggcgtcgaacttcgagcgcttcgtgttcgac
ctgctcggccgcgatccggcgcgcgtgatgcagctgttccgcgacgtcgaggagaagggc
ggcttcgatctcgccgcgagcggcgatttcgcgcgcgtggccgagttcggtttcgtgtcg
ggccgcagcagccacaccgaccgcatcgcgacgatccgcgacgtgttctcgcgttacgac
acgatgatcgatacgcacacggccgacggcgtgaaggtcgcgcgcgagcatctggacgcg
ggcgtgccgatggtcgtgctcgaaaccgcgcagccgatcaagttcggcgagacgattcgc
gaagcgctcgatcgcgaagccgagcgtccggccgcgttcgacgggctcgaggcgctgccg
cagcgcttcgaggtcgtgaaggccgacgcgcagcaggtgaaggacttcatcgccgcccat
acgggcgcatga

DBGET integrated database retrieval system