KEGG   Bacillus megaterium NBRC 15308 = ATCC 14581: BG04_2592
Entry
BG04_2592         CDS       T03825                                 
Name
(GenBank) basic membrane family protein
  KO
K05519  transcriptional activator of comK gene
Organism
bmeg  Bacillus megaterium NBRC 15308 = ATCC 14581
Brite
KEGG Orthology (KO) [BR:bmeg00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:bmeg03000]
    BG04_2592
Transcription factors [BR:bmeg03000]
 Prokaryotic type
  Other transcription factors
   Others
    BG04_2592
SSDB
Motif
Pfam: Bmp Phage_cap_E Arch_flagellin CoA_binding_2 AIRC Mrr_cat
Other DBs
NCBI-ProteinID: AJI23373
UniProt: A0A0B6ART1
LinkDB
Position
2415353..2416336
AA seq 327 aa
MQRSRQLRLILLLALIVVASFLIIIISKTHGIISQQTTKKVENTSVAILTSDVLTDQSWG
SLAYKGKINIEQQYPVSAQVISEVNTNQKMKEAAEKVIQNGTKVVIGHGREFSTVFTELA
PKYPHVHFVTIHGTSMYKNQTVYTFDQTKIEHLAGMAAAMKTKTKKIGLLDTFAKEKNPG
FEQGIKAYDSSIAFYYRVVNSRDDGAKAVKLLRELKDQGVDIVYAKGNSYNQEVIQEAKT
QGMYVIGYLDDQAYMGRSVILTSVINDVPQAYNVIMKDYFSKKGLPSGEVKLDARDGVYK
LAPFGPMYSKREKQILYSKVRMSTQPK
NT seq 984 nt   +upstreamnt  +downstreamnt
atgcaacgatcaagacagttaaggctgattttattgcttgccctgattgttgtcgcttcg
tttttaattattattatttcgaaaacacatgggattataagtcagcaaacgacaaaaaaa
gtagaaaacacaagcgttgcaattctcacctctgatgtactgacggatcaaagctggggc
agtctagcttataaaggaaaaatcaacattgagcagcagtatcctgtttcggctcaagtt
attagcgaagtaaatacgaaccaaaaaatgaaggaagctgctgaaaaagttattcaaaat
ggaacaaaagtcgtaattggacatggaagagaattttctaccgtttttacagaactagct
cctaagtatcctcatgttcatttcgtcaccattcacggtacttcaatgtataaaaaccaa
actgtatatacatttgatcaaacaaaaatagagcacctggcaggcatggcagctgccatg
aagacaaaaacgaaaaaaattggattactcgatacatttgcaaaagaaaaaaatccagga
tttgaacaaggaatcaaagcgtatgattcatcgattgctttttattatcgagttgtaaac
agccgagacgatggagcaaaagcagtaaagctgctccgtgagttaaaagatcaaggtgtt
gatatcgtctatgctaaaggaaattcgtataatcaagaagttattcaagaagcaaaaaca
caaggaatgtacgtaatagggtatttagatgatcaggcgtacatgggtaggtctgttatt
ttaaccagcgtgatcaacgatgttcctcaagcttacaacgtgattatgaaagactatttc
agtaaaaaaggtcttccatctggagaagtcaagcttgacgctagggatggtgtttataaa
ctagcgccttttggaccgatgtacagtaaacgggaaaaacaaattttatattcgaaagtt
agaatgtctacacagccgaagtaa

DBGET integrated database retrieval system