Botrimarina mediterranea: Spa11_15140 Help Entry Spa11_15140       CDS       T09862                                  Symbol acpP_2 Name (GenBank) Acyl carrier protein   KO K02078   acyl carrier protein Organism bmei  Botrimarina mediterranea Pathway bmei01100   Metabolic pathways bmei01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:bmei00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     Spa11_15140 (acpP_2)    00074 Mycolic acid biosynthesis     Spa11_15140 (acpP_2)   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     Spa11_15140 (acpP_2) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding Motif Other DBs NCBI-ProteinID:  QDV73318 UniProt:  A0A518K6B2 LinkDB All DBs Position complement(1834430..1834690) Genome browser AA seq 86 aa AA seqDB search MTRDEIRDEILDILGDIAPDEDLSELKDEQSFREQMELDSMDFLDIVMELRKRHRVQIPE DDYVELASMSSTVNYLEPLMKDIAKA NT seq 261 nt NT seq  +upstreamnt  +downstreamnt atgacgcgtgatgagattcgcgacgagatcctcgacatcctcggcgacatcgctcccgac gaggacctttcggagctgaaagacgaacagtccttccgcgagcagatggagctcgactcg atggacttcctcgacatcgtcatggagctgcgcaagcgtcaccgcgtgcagatccccgag gacgactacgtcgaactggcgagcatgagctcaacggtcaactacctcgagccgctgatg aaggatatcgccaaggcctga

DBGET integrated database retrieval system