Botrimarina mediterranea: Spa11_37160 Help Entry Spa11_37160       CDS       T09862                                  Symbol acpP_3 Name (GenBank) Acyl carrier protein   KO K02078   acyl carrier protein Organism bmei  Botrimarina mediterranea Pathway bmei01100   Metabolic pathways bmei01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:bmei00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     Spa11_37160 (acpP_3)    00074 Mycolic acid biosynthesis     Spa11_37160 (acpP_3)   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     Spa11_37160 (acpP_3) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding ACP_SdgA_C PP-binding_2 DUF1493 Ribosomal_L12_N Tautomerase DUF5783 Tas3-like_N Motif Other DBs NCBI-ProteinID:  QDV75498 UniProt:  A0A518KCJ7 LinkDB All DBs Position 4704988..4705272 Genome browser AA seq 94 aa AA seqDB search MGKSDNQATVRRVTVASVLERVTEIVSEQLGVDKDKITPETSFVTDLGADSLDTVELVME LEEEFDINIPDDAAEKIQTVGQAVAFIEKEQGGE NT seq 285 nt NT seq  +upstreamnt  +downstreamnt atggggaaatctgacaaccaggcgacagtaaggagagtgaccgtggcaagcgtgctggaa cgcgtgacggagatcgtgtccgagcaactcggcgtcgataaggacaagatcacgccagag acctcgttcgtgaccgacctgggcgccgactcgctcgacacggtcgagttggtcatggaa ctcgaggaagagttcgacatcaacatccccgacgacgccgccgagaagatccagaccgtg ggtcaagcggtggcgttcatcgaaaaggaacagggcggcgagtga

DBGET integrated database retrieval system