Brucella melitensis bv. 1 16M: DK63_2488 Help Entry DK63_2488         CDS       T03831                                  Name (GenBank) cyd operon protein YbgT   KO K00424   cytochrome bd-I ubiquinol oxidase subunit X [EC:7.1.1.7] Organism bmel  Brucella melitensis bv. 1 16M Pathway bmel00190   Oxidative phosphorylation bmel01100   Metabolic pathways bmel02020   Two-component system Module bmel_M00153   Cytochrome bd ubiquinol oxidase Brite KEGG Orthology (KO) [BR:bmel00001]  09100 Metabolism   09102 Energy metabolism    00190 Oxidative phosphorylation     DK63_2488  09130 Environmental Information Processing   09132 Signal transduction    02020 Two-component system     DK63_2488 Enzymes [BR:bmel01000]  7. Translocases   7.1  Catalysing the translocation of protons    7.1.1  Linked to oxidoreductase reactions     7.1.1.7  quinol oxidase (electrogenic, proton-motive force generating)      DK63_2488 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  YbgT_YccB Hemotin Motif Other DBs NCBI-ProteinID:  AIJ87611 UniProt:  Q8YBX8 LinkDB All DBs Position 2:421234..421389 Genome browser AA seq 51 aa AA seqDB search MWYFSWLLGLPLAAAFAVLNAMWYELMDDRARKRLAADPTAELALEGNKHH NT seq 156 nt NT seq  +upstreamnt  +downstreamnt atgtggtatttttcctggcttttgggcctgccgcttgcagccgcgttcgctgtgctgaat gcgatgtggtatgagctgatggacgaccgggcgcgcaagcgccttgccgccgaccccacg gcggaactggcccttgaaggcaacaagcaccactga

DBGET integrated database retrieval system