Brucella melitensis bv. 1 16M: DK63_2758
Help
Entry
DK63_2758 CDS
T03831
Name
(GenBank) binding--dependent transport system inner membrane component family protein
KO
K02053
putative spermidine/putrescine transport system permease protein
Organism
bmel
Brucella melitensis bv. 1 16M
Pathway
bmel02024
Quorum sensing
Brite
KEGG Orthology (KO) [BR:
bmel00001
]
09140 Cellular Processes
09145 Cellular community - prokaryotes
02024 Quorum sensing
DK63_2758
09180 Brite Hierarchies
09183 Protein families: signaling and cellular processes
02000 Transporters [BR:
bmel02000
]
DK63_2758
Transporters [BR:
bmel02000
]
ABC transporters, prokaryotic type
Mineral and organic ion transporters
Putative spermidine/putrescine transporter
DK63_2758
BRITE hierarchy
SSDB
Ortholog
Paralog
Gene cluster
GFIT
Motif
Pfam:
BPD_transp_1
Motif
Other DBs
NCBI-ProteinID:
AIJ88368
LinkDB
All DBs
Position
2:complement(709816..710658)
Genome browser
AA seq
280 aa
AA seq
DB search
MIRDTSTGAKLWIAAVWAVVIFFVINLTAMIATVVLSSFSTRWLGTWLPAGLTTKWYYTA
WSEFQLHDVLIVTFQIVFTVVILSGLLGVTAAYAMARRNFPGRNIVMLLFLLPLLVPPIT
FGIPLATVLYQAGTGGTFWGVVLANLVPTVPFVILVMIPFIEQVDPKVEAAARVFGANTF
QLFRYVLLPMLLPGILAALLLVLVRTVAMFELTFLTAGPTSQTLVVALYYSVFASGVRSV
QSIDAMAVIYMITTLIWLLLALRFVNPTQIVARAKSQNTN
NT seq
843 nt
NT seq
+upstream
nt +downstream
nt
atgatcagagatacttccacaggtgccaaactctggattgcagccgtgtgggctgttgtg
atcttcttcgtgatcaacctgacggcaatgattgcaaccgttgttctgtcatctttttcg
acaagatggcttggcacctggttgcccgccgggcttaccacaaaatggtattatacagcc
tggagcgaattccagcttcatgatgtcctgatcgttacctttcagattgtattcacagtg
gtgatcttgtccgggctgttgggtgtcacggcggcatatgccatggcgcggcgtaatttt
cccggccgcaacattgtcatgctcctgtttctgctgcccttgctggtgccgccaattacg
tttggcattccattggcgacggtcctctatcaggcagggaccggtggcacattctggggt
gtcgtgcttgccaaccttgtaccaacggttccattcgtcattctcgtcatgatccccttc
atcgaacaggtcgatccaaaagtggaagctgccgcgcgcgtttttggcgccaacaccttc
caactgtttcgctatgttttgttgccgatgctgctgccgggcatcttggctgcgttactg
cttgtgctggtgcgtacggtcgcgatgttcgagctgacattccttactgccgggccaacc
agccagacgctcgtggttgcactctattattccgtattcgcatccggtgtgcgttcggtt
cagtccattgatgcgatggcagtcatatacatgatcaccacacttatctggctcctgctg
gctttgcgcttcgtgaacccgacacagatcgttgcgcgcgcaaaatcccaaaacaccaac
taa
DBGET
integrated database retrieval system