KEGG   Brucella melitensis bv. 1 16M: DK63_535
Entry
DK63_535          CDS       T03831                                 
Symbol
coaD
Name
(GenBank) pantetheine-phosphate adenylyltransferase
  KO
K00954  pantetheine-phosphate adenylyltransferase [EC:2.7.7.3]
Organism
bmel  Brucella melitensis bv. 1 16M
Pathway
bmel00770  Pantothenate and CoA biosynthesis
bmel01100  Metabolic pathways
bmel01240  Biosynthesis of cofactors
Module
bmel_M00120  Coenzyme A biosynthesis, pantothenate => CoA
Brite
KEGG Orthology (KO) [BR:bmel00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00770 Pantothenate and CoA biosynthesis
    DK63_535 (coaD)
Enzymes [BR:bmel01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.3  pantetheine-phosphate adenylyltransferase
     DK63_535 (coaD)
SSDB
Motif
Pfam: CTP_transf_like Citrate_ly_lig
Other DBs
NCBI-ProteinID: AIJ90389
UniProt: P63814
LinkDB
Position
1:complement(538574..539068)
AA seq 164 aa
MTIAIYAGSFDPVTNGHIDVLKGALRLADQVIVAIGMHPGKKPLFSFDERVALIEASAKA
VLHKDAARVSVIAFDGLVIDAARKHGAQLMVRGLRDGTDLDYEMQMAGMNGTMAPELQTV
FLPADPAVRTITATLVRQIASMGGDIKPFVPVAVAAALNTKFKS
NT seq 495 nt   +upstreamnt  +downstreamnt
atgacgatcgcgatctatgcgggttcctttgacccggtaaccaacggccatatagatgtc
cttaaaggggccttgcgccttgccgatcaggttattgttgccatcggcatgcatcctggc
aaaaaaccgcttttcagttttgatgagcgcgttgcgcttattgaggcaagtgcgaaggcg
gttctgcacaaggatgctgcgcgtgtttccgtcatcgcttttgatgggctggtcattgat
gctgcgcgcaagcatggggcgcaattgatggtacggggcttgcgtgacggcaccgacctt
gattacgaaatgcagatggctggcatgaacggcaccatggcgccggaattgcagacggtt
tttctacctgccgatccggcagtgcgcacgattaccgccacattggttcgccagattgcg
tccatgggcggggacatcaagcccttcgttccggtggccgtcgctgccgccttgaacacc
aaattcaaatcctga

DBGET integrated database retrieval system