Bacillus methanolicus: BMMGA3_15010 Help Entry BMMGA3_15010      CDS       T03209                                  Name (GenBank) hypothetical protein   KO K02398   negative regulator of flagellin synthesis FlgM Organism bmet  Bacillus methanolicus Pathway bmet02020   Two-component system bmet02040   Flagellar assembly Brite KEGG Orthology (KO) [BR:bmet00001]  09130 Environmental Information Processing   09132 Signal transduction    02020 Two-component system     BMMGA3_15010  09140 Cellular Processes   09142 Cell motility    02040 Flagellar assembly     BMMGA3_15010  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    02035 Bacterial motility proteins [BR:bmet02035]     BMMGA3_15010 Bacterial motility proteins [BR:bmet02035]  Flagellar system   Flagellar assembly proteins    Others     BMMGA3_15010 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  FlgM DUF5401 SegE_GIY-YIG DUF5803 Motif Other DBs NCBI-ProteinID:  AIE61359 UniProt:  I3EB04 LinkDB All DBs Position complement(2973847..2974113) Genome browser AA seq 88 aa AA seqDB search MKINNFGPSGVNPYKRQMDKLNQVERAAGKKADKVEISEAAKELQQVSQFEKERQAKVNA LKMQIENGTYKPNPKEIAKSIVNFYFNK NT seq 267 nt NT seq  +upstreamnt  +downstreamnt atgaaaatcaataactttggaccgtcaggagtcaatccttataagcggcaaatggataag ctcaaccaagtggaaagagcagccggcaagaaagcggataaagttgaaatttccgaagct gccaaagagcttcagcaagtttcgcaattcgaaaaagaacggcaagcaaaagtaaatgca ctaaaaatgcaaattgaaaacggtacttataaaccgaatccaaaagaaattgcgaaaagt atcgtgaatttttattttaataaataa

DBGET integrated database retrieval system