Brucella abortus 2308: BAB1_0699 Help Entry BAB1_0699         CDS       T00304                                  Name (GenBank) 2-isopropylmalate synthase   KO K01649   2-isopropylmalate synthase [EC:2.3.3.13] Organism bmf  Brucella abortus 2308 Pathway bmf00290   Valine, leucine and isoleucine biosynthesis bmf00620   Pyruvate metabolism bmf01100   Metabolic pathways bmf01110   Biosynthesis of secondary metabolites bmf01210   2-Oxocarboxylic acid metabolism bmf01230   Biosynthesis of amino acids Module bmf_M00432   Leucine biosynthesis, 2-oxoisovalerate => 2-oxoisocaproate Brite KEGG Orthology (KO) [BR:bmf00001]  09100 Metabolism   09101 Carbohydrate metabolism    00620 Pyruvate metabolism     BAB1_0699   09105 Amino acid metabolism    00290 Valine, leucine and isoleucine biosynthesis     BAB1_0699 Enzymes [BR:bmf01000]  2. Transferases   2.3  Acyltransferases    2.3.3  Acyl groups converted into alkyl groups on transfer     2.3.3.13  2-isopropylmalate synthase      BAB1_0699 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Other DBs NCBI-ProteinID:  CAJ10655 UniProt:  Q2YN20 LinkDB All DBs Position I:681449..681583 Genome browser AA seq 44 aa AA seqDB search MARERIYIYDTTSADGQQTLPARPQPRSERGRAKAKAGACLGGQ NT seq 135 nt NT seq  +upstreamnt  +downstreamnt atggcacgcgagcgcatttatatctacgacaccacctcggcggatgggcagcaaacgtta cccgcccgcccgcagccgcgaagcgagcgaggacgggcaaaggcaaaagcgggcgcttgc ctgggagggcaatga

DBGET integrated database retrieval system