KEGG   Brucella abortus 2308: BAB1_1456
Entry
BAB1_1456         CDS       T00304                                 
Name
(GenBank) Beta-lactamase, class A:Penicillin-binding protein, transpeptidase domain:ATP/GTP-binding site motif A (P-loop):Penicillin-bi...
  KO
K03587  cell division protein FtsI (penicillin-binding protein 3) [EC:3.4.16.4]
Organism
bmf  Brucella abortus 2308
Pathway
bmf00550  Peptidoglycan biosynthesis
bmf01100  Metabolic pathways
bmf01501  beta-Lactam resistance
Brite
KEGG Orthology (KO) [BR:bmf00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    BAB1_1456
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01501 beta-Lactam resistance
    BAB1_1456
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:bmf01011]
    BAB1_1456
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:bmf03036]
    BAB1_1456
Enzymes [BR:bmf01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.16  Serine-type carboxypeptidases
    3.4.16.4  serine-type D-Ala-D-Ala carboxypeptidase
     BAB1_1456
Peptidoglycan biosynthesis and degradation proteins [BR:bmf01011]
 Peptidoglycan biosynthesis and degradation
  DD-Transpeptidase (Class B PBP)
   BAB1_1456
Chromosome and associated proteins [BR:bmf03036]
 Prokaryotic type
  Chromosome partitioning proteins
   Divisome proteins
    BAB1_1456
SSDB
Motif
Pfam: Transpeptidase PBP_dimer Beta-lactamase
Other DBs
NCBI-ProteinID: CAJ11412
UniProt: Q2YM65
LinkDB
Position
I:complement(1411277..1413100)
AA seq 607 aa
MRLRLFSAKKKAPDGSIHGEVPAGDEKLAGNMAFVGSRKRHGNRARNRLWMAIACFAGIY
GVMAGKLVYFGMIGGVDQDAAGPFVHQLASRPDILDRNGEILATDIKTASLYAEPRKIVD
PDETIEMLSTVLPDLDWEATYKRLKSGAGFVWIKRGLTPKQQSQIMALGVPGIGFRTEKR
RFYPGGPTASHILGLVNVDNQGIAGMEKYIDSQGLSDLRSVGLATGQSLEPVHLSIDIRV
QHIMRDVLVKAMERYRAIAAGAVVLNVKTGEVIAMSSVPDFDPNNPVHALDKDRLNRMSA
GTYEMGSTIKSFTTAMALDSGKFTLQSKLDASRPLVFGRQTIRDFHGKGRWLTLPEVFIF
SSNIGSGREADAVGIEGHRAFLKKIGLLDRMQTELPEVARPVEPRVWKKVHSMTISFGHG
MMTTPLQTAVGAAALMNGGKLIEPTFLPRTEAQAARASKQVIHPQVSADMRYLYRLNSTA
PGGSGRRATVPGYRVGGKTGTAEKVINGRYSKDVRFNAFLASFPMDNPTYVVLTIIDEPK
PEEGKFSATAGLNAAPMVAEIIRRSASFLGVSPDFRKEALPASVENVSGRPDFQQEVPPA
MVSNEYD
NT seq 1824 nt   +upstreamnt  +downstreamnt
atgcggctgagattgttttcggcaaagaaaaaggcgcctgatggctccattcacggtgaa
gtgccggccggtgatgaaaagctggccggtaatatggcgtttgtcggctcgcgcaagcgc
catggcaaccgcgcgcgcaaccggctctggatggccattgcctgtttcgccggcatttat
ggcgtgatggctggcaagcttgtctatttcggcatgatcggtggcgtggatcaagatgcc
gccggtccgtttgtgcaccagcttgcatcacgccccgacattcttgaccgcaatggcgaa
attctcgcaaccgatatcaagaccgcatcgctctatgcggagccgcgcaagatcgtggac
ccggacgaaaccatcgaaatgctgtcgactgttttgccggatctcgactgggaggcgacc
tataagcgcctgaagagtggggccggtttcgtctggatcaagcgcgggctgacgccgaag
cagcaaagccagatcatggcgctcggtgtgccgggcattggcttccgcacggaaaaacgc
cgcttttatcccggtggcccgaccgcttcgcatattctcggtctcgtcaatgtcgataat
cagggcattgcgggcatggagaaatatatcgatagccaggggctgagcgatctgcgctcc
gtcggccttgcaacggggcagtcgctggagccggtgcatctttccatcgatattcgcgtg
cagcacatcatgcgcgatgttctggtcaaggccatggagcgctaccgggcaatcgcggct
ggcgctgtggtgctgaacgtcaagacgggcgaagtgatcgccatgtcgtccgtaccggat
ttcgacccgaataatccggtgcacgcgctggacaaggatcgcctcaaccgcatgtcggca
ggcacttatgaaatgggctcgaccatcaagagcttcacgacggccatggcgctcgattcc
ggcaagttcaccttgcagtcgaagctcgacgcctcgcgtccgctggtgttcggccgccag
accatccgcgacttccacggcaagggccgctggctcaccttgccggaggttttcatcttc
tcgtccaatatcggttcaggccgtgaagcggacgccgtcggcatcgaagggcatcgcgcc
ttcctcaagaagatcggccttctcgaccgtatgcagacggaattgccggaagtggcgcgc
cccgttgagccgcgcgtgtggaaaaaggttcattccatgaccatttccttcggtcacggc
atgatgaccacgccgcttcagacggctgtgggggctgccgctttgatgaatggcggcaag
ctgatcgagccgactttcctgccgcgtacggaagcgcaggcggctcgggccagcaagcag
gtgatccatccacaggtttctgccgatatgcgctatctctaccggctgaactcaactgcc
cctggcggttcgggccggcgcgcgacggttccgggctaccgtgtcggtggcaagaccggc
acggcggaaaaggtgatcaatggccgctattccaaggatgtgcgcttcaacgctttcctg
gcgtcattcccgatggataatcccacctatgtcgtgcttaccatcattgatgagccgaag
ccggaagagggcaagttcagcgccaccgccggtcttaatgcggcgcccatggtggctgaa
atcattcgccgttccgcatcatttcttggggtcagtcccgatttccgcaaggaagctttg
cctgcttcggtggaaaacgtcagcggcaggcccgattttcaacaggaagtgccgccagca
atggtttcaaacgaatacgattga

DBGET integrated database retrieval system