Brucella abortus 2308: BAB1_1833 Help Entry BAB1_1833         CDS       T00304                                  Name (GenBank) Chorismate mutase   KO K04092   chorismate mutase [EC:5.4.99.5] Organism bmf  Brucella abortus 2308 Pathway bmf00400   Phenylalanine, tyrosine and tryptophan biosynthesis bmf01100   Metabolic pathways bmf01110   Biosynthesis of secondary metabolites bmf01230   Biosynthesis of amino acids Brite KEGG Orthology (KO) [BR:bmf00001]  09100 Metabolism   09105 Amino acid metabolism    00400 Phenylalanine, tyrosine and tryptophan biosynthesis     BAB1_1833 Enzymes [BR:bmf01000]  5. Isomerases   5.4  Intramolecular transferases    5.4.99  Transferring other groups     5.4.99.5  chorismate mutase      BAB1_1833 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  CM_2 Motif Other DBs NCBI-ProteinID:  CAJ11789 UniProt:  Q2YLK5 LinkDB All DBs Position I:complement(1772306..1772620) Genome browser AA seq 104 aa AA seqDB search MSNEQNTIPAELLALRASIDNIDAALIHMLAERFRCTKAVGVLKAERGLAPADPAREKRQ VARLRALAADANLDPDFAEKFLNFIVKEVIRHHEHTAANHGGNQ NT seq 315 nt NT seq  +upstreamnt  +downstreamnt atgagcaacgagcagaacaccatacccgctgagcttctggcgctgcgtgcatcgatcgac aatatcgacgctgccctcattcatatgttggccgaacgctttcgctgcacgaaggctgtc ggcgtattgaaggccgagcgaggtctggcaccggctgatccggcccgcgagaagcgccag gtggcgcggctgcgcgcgctggccgcagatgccaatctcgatcccgattttgctgaaaag ttcctgaactttatcgtgaaggaagtcattcggcatcatgagcataccgccgccaaccat ggcggaaaccaatag

DBGET integrated database retrieval system