Brucella melitensis M5-90: BM590_A0477 Help Entry BM590_A0477       CDS       T01849                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism bmg  Brucella melitensis M5-90 Pathway bmg01100   Metabolic pathways bmg01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:bmg00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     BM590_A0477    00074 Mycolic acid biosynthesis     BM590_A0477   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     BM590_A0477 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 Ribosomal_L12_N ACP_SdgA_C Motif Other DBs NCBI-ProteinID:  ADZ86421 LinkDB All DBs Position I:478891..479127 Genome browser AA seq 78 aa AA seqDB search MSDTAERVKKIVVEHLGVDADKVTEGASFIDDLGADSLDTVELVMAFEEEFGVEIPDDAA ETILTVGDAVKFIDKASA NT seq 237 nt NT seq  +upstreamnt  +downstreamnt atgagcgataccgcagagcgcgtcaagaaaatcgttgttgaacatctgggcgtagatgcc gacaaggtcacggaaggcgcaagcttcattgatgacctcggcgcagacagcctcgacacc gtcgagctggtcatggcctttgaagaagaattcggcgttgaaattcctgacgacgctgcc gaaacgatccttacggtcggtgatgctgtgaagttcatcgataaggcttctgcctga

DBGET integrated database retrieval system