Brucella melitensis ATCC 23457: BMEA_A1875 Help Entry BMEA_A1875        CDS       T00867                                  Name (GenBank) chorismate mutase   KO K04092   chorismate mutase [EC:5.4.99.5] Organism bmi  Brucella melitensis ATCC 23457 Pathway bmi00400   Phenylalanine, tyrosine and tryptophan biosynthesis bmi01100   Metabolic pathways bmi01110   Biosynthesis of secondary metabolites bmi01230   Biosynthesis of amino acids Brite KEGG Orthology (KO) [BR:bmi00001]  09100 Metabolism   09105 Amino acid metabolism    00400 Phenylalanine, tyrosine and tryptophan biosynthesis     BMEA_A1875 Enzymes [BR:bmi01000]  5. Isomerases   5.4  Intramolecular transferases    5.4.99  Transferring other groups     5.4.99.5  chorismate mutase      BMEA_A1875 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  CM_2 Motif Other DBs NCBI-ProteinID:  ACO01547 UniProt:  C0RF75 LinkDB All DBs Position I:complement(1776698..1777012) Genome browser AA seq 104 aa AA seqDB search MSNEQNTIPAELLALRASIDNIDAALIHMLAERFRCTKAVGVLKAERGLAPADPAREKRQ VARLRALAADANLDPDFAEKFLNFIVKEVIRHHEHTAANHGGNQ NT seq 315 nt NT seq  +upstreamnt  +downstreamnt atgagcaacgagcagaacaccatacccgctgagcttctggcgctgcgtgcatcgatcgac aatatcgacgctgccctcattcatatgttggccgaacgctttcgctgcacgaaggctgtc ggcgtattgaaggccgagcgaggtctggcaccggctgatccggcccgcgagaagcgccag gtggcgcggctgcgcgcgctggccgcagatgccaatctcgatcccgattttgctgaaaag ttcctgaactttatcgtgaaggaagtcattcggcatcatgagcataccgccgccaaccat ggcggaaaccaatag

DBGET integrated database retrieval system