Babesia microti: BMR1_02g00625 Help Entry BMR1_02g00625     CDS       T05554                                  Name (RefSeq) dynein light chain LC8-type   KO K10418   dynein light chain LC8-type Organism bmic  Babesia microti Pathway bmic04145   Phagocytosis bmic04517   IgSF CAM signaling bmic04814   Motor proteins Brite KEGG Orthology (KO) [BR:bmic00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04517 IgSF CAM signaling     BMR1_02g00625  09140 Cellular Processes   09141 Transport and catabolism    04145 Phagocytosis     BMR1_02g00625   09142 Cell motility    04814 Motor proteins     BMR1_02g00625  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    03037 Cilium and associated proteins [BR:bmic03037]     BMR1_02g00625    04812 Cytoskeleton proteins [BR:bmic04812]     BMR1_02g00625 Cilium and associated proteins [BR:bmic03037]  Motile cilia and associated proteins   Dynein arm    BMR1_02g00625 Cytoskeleton proteins [BR:bmic04812]  Eukaryotic cytoskeleton proteins   Microtubules    Tubulin-binding proteins     Dyneins      BMR1_02g00625 SSDB OrthologParalogGFIT Motif Pfam:  Dynein_light Motif Other DBs NCBI-GeneID:  24423915 NCBI-ProteinID:  XP_012647900 UniProt:  I7IG27 LinkDB All DBs Position II Genome browser AA seq 91 aa AA seqDB search MDVETKEITVKSVDMDESMQKDALEVAQQAMSKFTVEKDIAGFIKKDFDRRYNPTWHCIV GRNFGSYVTHETRCFIYFYVAQTAILLFKNG NT seq 276 nt NT seq  +upstreamnt  +downstreamnt atggacgttgaaactaaagaaataactgtgaaaagtgtcgatatggatgagtccatgcaa aaagatgctctggaggttgcgcaacaggcaatgagcaaatttactgtcgaaaaggacatt gctggctttatcaaaaaggactttgacagacgctacaatcctacatggcactgcattgtg ggtagaaactttggctcctatgtcactcatgagaccagatgttttatctacttttatgta gcgcaaactgctattcttctttttaagaatggttga

DBGET integrated database retrieval system