Burkholderia multivorans DDS 15A-1: DM80_1498 Help Entry DM80_1498         CDS       T03292                                  Name (GenBank) H-NS histone family protein   KO K03746   DNA-binding protein H-NS Organism bmk  Burkholderia multivorans DDS 15A-1 Brite KEGG Orthology (KO) [BR:bmk00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:bmk03036]     DM80_1498    03400 DNA repair and recombination proteins [BR:bmk03400]     DM80_1498 Chromosome and associated proteins [BR:bmk03036]  Prokaryotic type   Nucleoid associated proteins    HNS (histone-like nucleoid structuring protein)     DM80_1498 DNA repair and recombination proteins [BR:bmk03400]  Prokaryotic type   DSBR (double strand breaks repair)    NHEJ (non-homologous end-joining)     SHDIR (short-homology-dependent illegitimate recombination)      Supressor       DM80_1498 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Histone_HNS Histone_HNS_N MAGE DUF4878 Motif Other DBs NCBI-ProteinID:  AIO76143 UniProt:  A0A1W0ZCV8 LinkDB All DBs Position 1:complement(1618225..1618518) Genome browser AA seq 97 aa AA seqDB search MSSYKDLLAQREKLEKQIEEAKAREYAEVLNDVKQKIADYGFSLAELGLSRAKAGKVGRP RAGVAAKYRDPESGATWSGRGKPPRWIAGKNREQFAI NT seq 294 nt NT seq  +upstreamnt  +downstreamnt atgtcttcttacaaggacctgctggcccagcgggagaagctggagaagcaaatcgaagaa gcgaaggcgcgtgaatacgccgaagtactcaatgacgtgaagcagaaaatcgccgactac ggcttttcgctcgcggaactcggcctgagccgcgcgaaagccggcaaagtcggccgcccg cgcgccggtgtggcggcaaaataccgcgatccggaatcgggcgcgacgtggtcgggccgc ggcaagccgccgcgctggatcgccggcaagaaccgcgaacagtttgcgatttaa

DBGET integrated database retrieval system