Burkholderia multivorans DDS 15A-1: DM80_517 Help Entry DM80_517          CDS       T03292                                  Symbol acpP Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism bmk  Burkholderia multivorans DDS 15A-1 Pathway bmk00998   Biosynthesis of various antibiotics bmk01100   Metabolic pathways bmk01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:bmk00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     DM80_517 (acpP)    00074 Mycolic acid biosynthesis     DM80_517 (acpP)   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     DM80_517 (acpP) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 DUF7080 Ribosomal_L50 DUF1896 DUF1493 Motif Other DBs NCBI-ProteinID:  AIO74828 UniProt:  A0A1B4TVV6 LinkDB All DBs Position 1:complement(594903..595142) Genome browser AA seq 79 aa AA seqDB search MDNIEQRVKKIVAEQLGVAEAEIKNEASFVNDLGADSLDTVELVMALEDEFGMEIPDEEA EKITTVQQAIDYARANVKA NT seq 240 nt NT seq  +upstreamnt  +downstreamnt atggacaacatcgaacaacgtgtcaagaagatcgtcgccgaacaactgggcgtcgccgaa gccgagatcaagaacgaagcttcgttcgtgaacgacctgggcgccgactcgctcgacacc gtcgaactggtgatggctctggaagacgagttcggcatggaaatcccggacgaagaggcg gagaagatcacgacggttcagcaagcgatcgactacgctcgcgcgaacgtcaaggcgtaa

DBGET integrated database retrieval system