Burkholderia multivorans DDS 15A-1: DM80_6103
Help
Entry
DM80_6103 CDS
T03292
Symbol
phnC
Name
(GenBank) phosphonate ABC transporter, ATP-binding protein
KO
K02041
phosphonate transport system ATP-binding protein [EC:
7.3.2.2
]
Organism
bmk
Burkholderia multivorans DDS 15A-1
Pathway
bmk02010
ABC transporters
Brite
KEGG Orthology (KO) [BR:
bmk00001
]
09130 Environmental Information Processing
09131 Membrane transport
02010 ABC transporters
DM80_6103 (phnC)
09180 Brite Hierarchies
09183 Protein families: signaling and cellular processes
02000 Transporters [BR:
bmk02000
]
DM80_6103 (phnC)
Enzymes [BR:
bmk01000
]
7. Translocases
7.3 Catalysing the translocation of inorganic anions and their chelates
7.3.2 Linked to the hydrolysis of a nucleoside triphosphate
7.3.2.2 ABC-type phosphonate transporter
DM80_6103 (phnC)
Transporters [BR:
bmk02000
]
ABC transporters, prokaryotic type
Phosphate and amino acid transporters
Phosphonate transporter
DM80_6103 (phnC)
BRITE hierarchy
SSDB
Ortholog
Paralog
Gene cluster
GFIT
Motif
Pfam:
ABC_tran
AAA_21
RsgA_GTPase
SMC_N
AAA_16
AAA_29
AAA_22
AAA_30
AAA_23
nSTAND1
NACHT
nSTAND3
AAA_27
ATP-synt_ab
AAA_28
Motif
Other DBs
NCBI-ProteinID:
AIO71233
LinkDB
All DBs
Position
3:complement(587993..588811)
Genome browser
AA seq
272 aa
AA seq
DB search
MIELQNVSVSYGDAIALYPTTLKLHQGQFTVLLGSSGAGKSTLLRCINSLHASQRGTTIV
AGLGNLANSRALRMHRRQTGMVFQQHQLIGRLTALQNVSMGRMGYHTALRSLFPLPAKDQ
SICLQSLDRVGLLHKALSRVDALSGGQQQRIGIARALAQQPKLVLADEPVASLDPATAER
VLSLLHRICKEDGISAVVSLHQVDLAQRYADRIIGLSHGRVIFDAAPQTLDQASYDTLYE
QVPRSSLSVPQDAREERLIDTSFPMQLATVKD
NT seq
819 nt
NT seq
+upstream
nt +downstream
nt
atgatcgaactacagaatgtctcagtcagttatggtgatgcgattgcactgtatcccacc
actctcaaactccatcagggacagttcaccgtattgctcggatcttccggcgctggaaaa
tccacgctacttcgctgtattaattcgctgcatgcgtcgcagcgcggcaccaccattgtc
gccggcttaggaaatttggcgaactcgcgtgcattgcgcatgcatcgccgacagactggc
atggtgtttcaacagcatcaattgattggccgactgacggctttgcaaaacgtttcgatg
ggccgaatgggctaccacacggcattacgcagtctattccccctcccggcgaaggatcaa
tccatatgcctgcaaagtctggaccgagtcggcttattgcacaaagccttaagccgtgtc
gacgcattgagcggcggccagcagcaacgcatcggtattgcccgggctctggctcagcaa
cctaaactggtgttggctgatgaaccggtagccagcctcgatcctgctactgcagagcga
gtgctaagtctgctgcaccgcatttgtaaagaggacgggatttcggcggtcgtcagcctg
catcaggtagacctcgctcaacgttatgccgaccgtattattggcctgtcccatggccga
gtcatttttgatgccgcaccgcagactttggatcaagccagttacgacacgctgtatgaa
caagtaccccgttcttctttgagcgttccacaagacgctcgagaggaacggcttatcgat
acttcatttcccatgcaacttgctaccgtaaaggattga
DBGET
integrated database retrieval system