Burkholderia mallei NCTC 10229: BMA10229_A0067 Help Entry BMA10229_A0067    CDS       T00471                                  Symbol hfq Name (GenBank) RNA chaperone Hfq   KO K03666   host factor-I protein Organism bml  Burkholderia mallei NCTC 10229 Pathway bml02024   Quorum sensing bml03018   RNA degradation Brite KEGG Orthology (KO) [BR:bml00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    03018 RNA degradation     BMA10229_A0067 (hfq)  09140 Cellular Processes   09145 Cellular community - prokaryotes    02024 Quorum sensing     BMA10229_A0067 (hfq)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03019 Messenger RNA biogenesis [BR:bml03019]     BMA10229_A0067 (hfq)    03036 Chromosome and associated proteins [BR:bml03036]     BMA10229_A0067 (hfq) Messenger RNA biogenesis [BR:bml03019]  Prokaryotic type   Bacterial mRNA degradation factors    Other RNA degradation factors     Chaperones      BMA10229_A0067 (hfq) Chromosome and associated proteins [BR:bml03036]  Prokaryotic type   Nucleoid associated proteins    Other nucleoid associated proteins     BMA10229_A0067 (hfq) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Hfq LSM Hfq_1 Motif Other DBs NCBI-ProteinID:  ABN00737 UniProt:  A2S2A7 LinkDB All DBs Position I:64218..64457 Genome browser AA seq 79 aa AA seqDB search MSNKGQLLQDPFLNALRKEHVPVSIYLVNGIKLQGNIESFDQYVVLLRNTVTQMVYKHAI STVVPARPVNFHPDAEAAS NT seq 240 nt NT seq  +upstreamnt  +downstreamnt atgagcaacaaagggcaattgttacaagacccgtttttgaacgcactgcgtaaagagcac gtgccggtttcgatctatctcgtgaacggcatcaagctccaagggaacatcgaatcgttc gaccagtacgtcgtgttgctccggaacacggttacccagatggtttacaagcacgccatt tcgacggtcgtgccggcgcgtccggtgaacttccacccggatgcggaagcagcgtcctaa

DBGET integrated database retrieval system