Burkholderia mallei NCTC 10229: BMA10229_A0173
Help
Entry
BMA10229_A0173 CDS
T00471
Symbol
truB
Name
(GenBank) tRNA pseudouridine synthase B
KO
K03177
tRNA pseudouridine55 synthase [EC:
5.4.99.25
]
Organism
bml
Burkholderia mallei NCTC 10229
Brite
KEGG Orthology (KO) [BR:
bml00001
]
09180 Brite Hierarchies
09182 Protein families: genetic information processing
03016 Transfer RNA biogenesis [BR:
bml03016
]
BMA10229_A0173 (truB)
Enzymes [BR:
bml01000
]
5. Isomerases
5.4 Intramolecular transferases
5.4.99 Transferring other groups
5.4.99.25 tRNA pseudouridine55 synthase
BMA10229_A0173 (truB)
Transfer RNA biogenesis [BR:
bml03016
]
Eukaryotic type
tRNA modification factors
Psudouridine synthases
BMA10229_A0173 (truB)
Prokaryotic type
BMA10229_A0173 (truB)
BRITE hierarchy
SSDB
Ortholog
Paralog
Gene cluster
GFIT
Motif
Pfam:
TruB_N
TruB_C_2
TruB-C_2
PUA_3
UPF0113
Motif
Other DBs
NCBI-ProteinID:
ABN01712
UniProt:
A2S2K9
LinkDB
All DBs
Position
I:complement(183853..184818)
Genome browser
AA seq
321 aa
AA seq
DB search
MSIARALVQTMTTVSPRPRMARRALDGVLLLDKPVGLSSNDALMRAKRLYQAKKAGHTGT
LDPLASGLLPLCFGEATKFSQDLLEADKTYEATMRLGVRTTTGDAEGDVLDTRDVSCDEA
AVRAALARFVGEIVQVPPMYSALKRDGKPLYEYARAGQTVEREGRTVTIRALALVSCALP
DVTFRVTCSKGTYVRTLAEDIGEALGCGAHLTMLRRTGVGPLTLEHAVTLDALDAATQDE
RDARLAPVDALLSTFPCVKLDAALATRFLHGQRLKLSELAARPDAAEGGRVRVYDADDRL
LGVARASEGVLAPERLVVTGA
NT seq
966 nt
NT seq
+upstream
nt +downstream
nt
ttgagtatcgcacgagccttggtgcagaccatgacgactgtttcgccccgcccccggatg
gcccgccgcgcgctcgatggcgtgctgctgctcgacaagccggtcggcctgtcgagcaac
gacgcgctgatgcgcgcgaagcgcctgtatcaggcgaagaaggcgggccacacgggcacg
ctcgatccgctcgcgtcgggactgctgccgctttgcttcggcgaagcgacgaagttctcg
caggacctgctcgaagccgacaagacctatgaagcgacgatgcggctcggcgtgcgcacg
acgacgggcgacgccgaaggcgacgtgctcgacacgcgcgacgtgagctgcgacgaagcg
gcggtccgcgcggcgctcgcgcgcttcgtcggcgagatcgtgcaagtgccgccgatgtac
tcggcgctcaagcgcgacggcaagccgctttacgaatacgcgcgcgccggccagacggtc
gagcgcgaagggcgcaccgtgacgatccgcgcgctcgcgctcgtgtcgtgcgcgttgccc
gacgtcacgtttcgcgtgacgtgcagcaagggcacgtacgtgcgcacgctcgccgaggat
atcggcgaagcgctcggttgcggcgcgcatctgacgatgttgcggcgcaccggggtcggc
ccgctgacgctcgagcacgcggtgacgctcgatgcgctcgacgccgcgacgcaggacgag
cgcgacgcgcggctcgcgcccgtcgatgcattgctgtcgacgtttccgtgcgtgaagctc
gatgcggcgctcgcgacgcgctttctgcacggccagcggctgaagctctccgagcttgcg
gcgcggcccgacgcggccgaaggtgggcgcgtgcgcgtctacgatgccgatgaccggctg
ctcggcgtcgcgcgcgcgtcggaaggcgtgctcgcgccggagcggctcgtcgtgacgggc
gcgtga
DBGET
integrated database retrieval system