Burkholderia mallei NCTC 10229: BMA10229_A1413 Help Entry BMA10229_A1413    CDS       T00471                                  Symbol grx3 Name (GenBank) glutaredoxin 3   KO K03676   glutaredoxin 3 Organism bml  Burkholderia mallei NCTC 10229 Brite KEGG Orthology (KO) [BR:bml00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03110 Chaperones and folding catalysts [BR:bml03110]     BMA10229_A1413 (grx3) Chaperones and folding catalysts [BR:bml03110]  Protein folding catalysts   Protein disulfide isomerase    BMA10229_A1413 (grx3) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Glutaredoxin GST_N_3 GST_N_2 Glrx-like Thioredoxin_2 DSBA Thioredoxin_3 Pyridoxal_deC Motif Other DBs NCBI-ProteinID:  ABN03071 UniProt:  A2S627 LinkDB All DBs Position I:1442634..1442894 Genome browser AA seq 86 aa AA seqDB search MNKVVMYSTQVCPYCMQAERLLKLRGVEHIEKVLIDKEPERRAEMMERTGRRTVPQIYIG DTHVGGYDDLSKLDREGGLKPLLEAA NT seq 261 nt NT seq  +upstreamnt  +downstreamnt gtgaacaaagtggtcatgtacagcacgcaggtgtgcccgtattgcatgcaggccgagcgg ctcctcaagctgcgcggcgtcgagcacatcgagaaagtgctgatcgacaaggagccggag cgccgcgcggagatgatggagcgcaccggccgccgcaccgtgccgcagatctacatcggc gacacgcacgtcggcggttacgacgacctgtcgaagctcgaccgcgaaggcggcctgaag ccgcttctcgaagccgcctga

DBGET integrated database retrieval system