Burkholderia mallei NCTC 10229: BMA10229_A1636 Help Entry BMA10229_A1636    CDS       T00471                                  Name (GenBank) H-NS histone family protein   KO K03746   DNA-binding protein H-NS Organism bml  Burkholderia mallei NCTC 10229 Brite KEGG Orthology (KO) [BR:bml00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:bml03036]     BMA10229_A1636    03400 DNA repair and recombination proteins [BR:bml03400]     BMA10229_A1636 Chromosome and associated proteins [BR:bml03036]  Prokaryotic type   Nucleoid associated proteins    HNS (histone-like nucleoid structuring protein)     BMA10229_A1636 DNA repair and recombination proteins [BR:bml03400]  Prokaryotic type   DSBR (double strand breaks repair)    NHEJ (non-homologous end-joining)     SHDIR (short-homology-dependent illegitimate recombination)      Supressor       BMA10229_A1636 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Histone_HNS Topoisom_I_N Motif Other DBs NCBI-ProteinID:  ABN03148 UniProt:  A2S6P7 LinkDB All DBs Position I:complement(1680442..1680735) Genome browser AA seq 97 aa AA seqDB search MSSYKDLLAQREKLEKQIEEAKSREYAEVLSDVKQKIADYGFTLAELGLGRGKAGKAGRP RAGVAAKYRDPESGATWSGRGKPPRWIAGKNREQFAI NT seq 294 nt NT seq  +upstreamnt  +downstreamnt atgtcttcttacaaggaccttctcgctcagcgagagaagctggagaagcagatcgaagaa gccaagtcgcgcgaatacgcggaggtattgagcgacgtcaagcaaaagatcgccgattac ggtttcacgctcgcggaactcggtctcggtcgtggcaaagctggaaaagcggggcgaccc cgcgctggcgtcgcggcgaaataccgcgatccggaatccggcgcaacctggtcgggccgc gggaagcctcctcgctggatcgccggcaagaatcgcgaacaattcgcgatctga

DBGET integrated database retrieval system