Burkholderia mallei NCTC 10229: BMA10229_A1665 Help Entry BMA10229_A1665    CDS       T00471                                  Name (GenBank) putative acyl carrier protein   KO K02078   acyl carrier protein Organism bml  Burkholderia mallei NCTC 10229 Pathway bml00998   Biosynthesis of various antibiotics bml01100   Metabolic pathways bml01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:bml00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     BMA10229_A1665    00074 Mycolic acid biosynthesis     BMA10229_A1665   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     BMA10229_A1665 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 Motif Other DBs NCBI-ProteinID:  ABN03406 UniProt:  A2S6S6 LinkDB All DBs Position I:complement(1705078..1705299) Genome browser AA seq 73 aa AA seqDB search MNAFYEGLAEIFEIDASEVTPALALGEHNWDSLAIVSTIALADDCFGVLLNGQALGNCKT VADIDALVAAQKG NT seq 222 nt NT seq  +upstreamnt  +downstreamnt atgaacgcattctacgaaggcctcgcggaaatcttcgagatcgacgcgagcgaagtcacg cccgcgctcgcgctcggcgagcacaactgggattcgcttgcgatcgtgtcgacgatcgcg ctcgccgacgactgcttcggcgtgctgctcaacggccaggcgctcggcaactgcaagacg gtcgccgatatcgacgcgctcgtcgcggcgcaaaagggctga

DBGET integrated database retrieval system