Burkholderia mallei NCTC 10247: BMA10247_0668 Help Entry BMA10247_0668     CDS       T00479                                  Name (GenBank) H-NS histone family protein   KO K03746   DNA-binding protein H-NS Organism bmn  Burkholderia mallei NCTC 10247 Brite KEGG Orthology (KO) [BR:bmn00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:bmn03036]     BMA10247_0668    03400 DNA repair and recombination proteins [BR:bmn03400]     BMA10247_0668 Chromosome and associated proteins [BR:bmn03036]  Prokaryotic type   Nucleoid associated proteins    HNS (histone-like nucleoid structuring protein)     BMA10247_0668 DNA repair and recombination proteins [BR:bmn03400]  Prokaryotic type   DSBR (double strand breaks repair)    NHEJ (non-homologous end-joining)     SHDIR (short-homology-dependent illegitimate recombination)      Supressor       BMA10247_0668 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Histone_HNS Motif Other DBs NCBI-ProteinID:  ABO05238 LinkDB All DBs Position I:complement(648006..648287) Genome browser AA seq 93 aa AA seqDB search METYLDLLAEREALMIKLDAARMQARSAALSEVKRIVEEFELTTQEVFGRAGVLRRRGKL KPKYRDPKTGATWNGRGRPPSWIAGKDRAAFVA NT seq 282 nt NT seq  +upstreamnt  +downstreamnt atggaaacctacctcgaccttctggccgaacgagaagccctgatgatcaagctggatgcg gcgcgcatgcaggcgcgcagcgccgcgctatccgaagtgaagcgaatcgtcgaggaattc gaactcacgacgcaggaagtgttcggccgcgcgggcgtgctgcgccgtcgcggcaagctc aagccgaagtatcgcgatccgaaaaccggcgcgacctggaacggccgcggccgcccgcct tcgtggatcgccggaaaggatcgcgccgcgttcgtcgcttga

DBGET integrated database retrieval system