Burkholderia mallei NCTC 10247: BMA10247_1764
Help
Entry
BMA10247_1764 CDS
T00479
Name
(GenBank) ABC transporter, permease/ATP-binding protein
KO
K06147
ATP-binding cassette, subfamily B, bacterial
Organism
bmn
Burkholderia mallei NCTC 10247
Brite
KEGG Orthology (KO) [BR:
bmn00001
]
09180 Brite Hierarchies
09183 Protein families: signaling and cellular processes
02000 Transporters [BR:
bmn02000
]
BMA10247_1764
Transporters [BR:
bmn02000
]
ABC transporters, eukaryotic type
ABCB (MDR/TAP) subfamily
ABCB-BAC subgroup
BMA10247_1764
BRITE hierarchy
SSDB
Ortholog
Paralog
Gene cluster
GFIT
Motif
Pfam:
ABC_tran
ABC_membrane
SMC_N
AAA_16
AAA_22
Zeta_toxin
AAA_24
ABC_ATPase
AAA_21
AAA_29
RsgA_GTPase
AAA_15
Motif
Other DBs
NCBI-ProteinID:
ABO06437
LinkDB
All DBs
Position
I:1752449..1754314
Genome browser
AA seq
621 aa
AA seq
DB search
MEALTPAQRNAHNAKLASYAERPLAFLFRYIRMHPVAHVVVLVSVLAAVGCALGSQYAIK
HLIDVLAAGRHHPGPLWGAFALLVGLIAADNLLWRVGGWVAAHAFVAVTGDLRRDLFQYL
SGHSPTYYAEKQPGTLASRITATSNAIYTSENTMAWNVLPPCIAVMGAILMIIVVNPLMA
LGLLSCSGVLAIVLFKLAKLGSARHHRFAAKAAAVDGELVDVIGNMGLVRAFGMTLREQK
RFSATVKAEMDARQQSLLYLEKLRLLHAVITAMLSAGLLGWALWLWDQGRATSGDIVLVS
SLGFTILHGTRDLAVALVDVTQHVARLAEAVKTLLEPHGMPDRSDAIALAPRGGRVDFER
VTFAYPHRRPILDHFDLHIEPGQRVGLIGKSGAGKSTVLALLQRFYDIQQGAIRIDGQDL
GTITQESLRQSIALVPQDISLFHRSIYENIAYGRPDATHEEVLAAAREARCTEFIEAMPE
GFETIVGDRGVKLSGGQRQRIAIARAILKNAPILLLDEATSALDSASEEAIQAALDRLMM
GRTVIAIAHRLSTLRNFDRIIVMSAGKVIDDGSPGVLRERPGLYRDLLAKQHGRHLAAPA
PAPAHDHSDDDDSSSDDERVA
NT seq
1866 nt
NT seq
+upstream
nt +downstream
nt
ttggaagctctcacccctgcccagcgcaacgcccacaacgcgaagctcgcgagctacgcc
gagcggccgctcgcgttcctgttccgctacatccggatgcacccggtcgcacacgtggtc
gtgctcgtcagcgtgctcgcggcggtcggctgcgcgctcggctcgcaatacgcgatcaag
cacctgatcgacgtgctcgccgccgggcgccatcatccggggccgctctggggcgcgttc
gcgctcctcgtcggcctgatcgccgcggacaacctgctctggcgcgtcggcggctgggtc
gccgcgcatgcgttcgtcgcggtgacgggcgatctgcgccgcgatctgttccagtatttg
agcgggcactcgccgacctactatgcggagaagcagcccggcacgctcgcgagccggatc
accgcgacgtcgaacgcgatctacacgtcggagaacacgatggcgtggaacgtgctgccg
ccgtgcatcgcggtgatgggcgcgatcctgatgatcatcgtcgtcaatccgctgatggcg
ctcggcctgctgtcgtgctccggtgtgctcgcgatcgtgctgttcaagctcgccaagctc
ggctcggcgcgccaccaccggttcgcggcgaaggcggcggccgtcgacggcgagctcgtc
gacgtgatcggcaacatggggctcgtgcgcgcgttcgggatgacgctgcgcgagcagaag
cgcttttccgcgaccgtgaaagccgagatggacgcgcgccagcagagcttgctctatctc
gagaagctgcgcctgctgcatgcggtgatcaccgcgatgctgtccgcgggcctgctcggc
tgggcgctgtggctgtgggaccagggccgcgcgacgtcgggcgacatcgtgctcgtcagc
tcgctcggcttcacgatcctgcacggcacgcgcgatctcgccgtcgcgctcgtcgacgtc
acgcagcacgtcgcgcgtctcgccgaggcggtgaagacgctgctcgagccgcacggaatg
cccgatcgctccgacgcgatcgcgctcgcgccgcgcggcggccgcgtcgacttcgagcgt
gtgacgttcgcgtatccgcaccgtcggccgatcctcgaccacttcgacctgcacatcgag
cccggccagcgggtcggcctgatcggcaagtcgggagcgggcaaatcgaccgtgctcgcg
ctgctgcagcgcttctacgacatccagcagggtgcgatccggatcgacggccaggacctc
ggcacgatcacgcaggagagcctgcgccagtcgatcgcgctcgtgccgcaggatatctcc
ctcttccatcggtcgatctacgagaacatcgcgtacggccgcccggacgcgacccacgag
gaagtgctcgccgccgcgcgcgaggcgcgctgcaccgaattcatcgaggcgatgccggag
ggcttcgagacgatcgtcggcgatcgcggcgtgaagctgtcgggcggccagcggcagcgg
atcgcgatcgcgcgcgcgatcctgaagaacgcgccgatcctgctgctcgacgaggcgaca
tcggcgctcgacagcgcctcggaggaagcgatccaggcggccctcgaccggctgatgatg
ggccgcaccgtgattgcgatcgcgcaccggctctcgacgctgcgcaacttcgaccggatc
atcgtgatgagcgcgggcaaggtgatcgacgacggcagccccggcgtgttgcgcgagcgc
ccgggcctgtaccgcgacctgctcgcgaagcagcacggccggcacctggccgcgccggcg
cccgcgcccgcgcacgaccatagcgacgacgacgattcgtcgtcggacgacgagcgcgtc
gcttaa
DBGET
integrated database retrieval system